Pongo abelii (Sumatran orangutan): 100171605 Help Entry 100171605         CDS       T01416                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04014   Ras signaling pathway pon04015   Rap1 signaling pathway pon04022   cGMP-PKG signaling pathway pon04024   cAMP signaling pathway pon04062   Chemokine signaling pathway pon04071   Sphingolipid signaling pathway pon04072   Phospholipase D signaling pathway pon04081   Hormone signaling pon04144   Endocytosis pon04150   mTOR signaling pathway pon04270   Vascular smooth muscle contraction pon04310   Wnt signaling pathway pon04350   TGF-beta signaling pathway pon04360   Axon guidance pon04510   Focal adhesion pon04520   Adherens junction pon04530   Tight junction pon04611   Platelet activation pon04621   NOD-like receptor signaling pathway pon04625   C-type lectin receptor signaling pathway pon04660   T cell receptor signaling pathway pon04670   Leukocyte transendothelial migration pon04722   Neurotrophin signaling pathway pon04810   Regulation of actin cytoskeleton pon04921   Oxytocin signaling pathway pon04928   Parathyroid hormone synthesis, secretion and action pon04972   Pancreatic secretion pon05100   Bacterial invasion of epithelial cells pon05132   Salmonella infection pon05133   Pertussis pon05135   Yersinia infection pon05152   Tuberculosis pon05163   Human cytomegalovirus infection pon05200   Pathways in cancer pon05203   Viral carcinogenesis pon05205   Proteoglycans in cancer pon05206   MicroRNAs in cancer pon05210   Colorectal cancer pon05417   Lipid and atherosclerosis pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100171605 (RHOA)    04015 Rap1 signaling pathway     100171605 (RHOA)    04310 Wnt signaling pathway     100171605 (RHOA)    04350 TGF-beta signaling pathway     100171605 (RHOA)    04072 Phospholipase D signaling pathway     100171605 (RHOA)    04071 Sphingolipid signaling pathway     100171605 (RHOA)    04024 cAMP signaling pathway     100171605 (RHOA)    04022 cGMP-PKG signaling pathway     100171605 (RHOA)    04150 mTOR signaling pathway     100171605 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     100171605 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100171605 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100171605 (RHOA)    04520 Adherens junction     100171605 (RHOA)    04530 Tight junction     100171605 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100171605 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100171605 (RHOA)    04621 NOD-like receptor signaling pathway     100171605 (RHOA)    04625 C-type lectin receptor signaling pathway     100171605 (RHOA)    04660 T cell receptor signaling pathway     100171605 (RHOA)    04670 Leukocyte transendothelial migration     100171605 (RHOA)    04062 Chemokine signaling pathway     100171605 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     100171605 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     100171605 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     100171605 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     100171605 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100171605 (RHOA)   09158 Development and regeneration    04360 Axon guidance     100171605 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100171605 (RHOA)    05206 MicroRNAs in cancer     100171605 (RHOA)    05205 Proteoglycans in cancer     100171605 (RHOA)    05203 Viral carcinogenesis     100171605 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     100171605 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100171605 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100171605 (RHOA)    05135 Yersinia infection     100171605 (RHOA)    05133 Pertussis     100171605 (RHOA)    05152 Tuberculosis     100171605 (RHOA)    05100 Bacterial invasion of epithelial cells     100171605 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100171605 (RHOA)    05418 Fluid shear stress and atherosclerosis     100171605 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100171605 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     100171605 (RHOA)    04031 GTP-binding proteins [BR:pon04031]     100171605 (RHOA) Membrane trafficking [BR:pon04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100171605 (RHOA) Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100171605 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    100171605 (RHOA)   Exosomal proteins of colorectal cancer cells    100171605 (RHOA)   Exosomal proteins of bladder cancer cells    100171605 (RHOA) GTP-binding proteins [BR:pon04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100171605 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  100171605 NCBI-ProteinID:  NP_001124755 Ensembl:  ENSPPYG00000013873 UniProt:  Q5REY6 LinkDB All DBs Position 2:105044708..105101356 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGRLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggaaagacatgc ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag aactatgtggcagatatcgaggtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcctgaggcccctctcctacccagatactgatgttata ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaagtggacc ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa cctgaagaaggcagagatatggcaaataggattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa gctagacgtgggaagaaaaaatctgggcgccttgtcctgtga

DBGET integrated database retrieval system