KEGG   Pongo abelii (Sumatran orangutan): 100171605
Entry
100171605         CDS       T01416                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA precursor
  KO
K04513  Ras homolog gene family, member A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04150  mTOR signaling pathway
pon04270  Vascular smooth muscle contraction
pon04310  Wnt signaling pathway
pon04350  TGF-beta signaling pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04520  Adherens junction
pon04530  Tight junction
pon04611  Platelet activation
pon04621  NOD-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04660  T cell receptor signaling pathway
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04921  Oxytocin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04972  Pancreatic secretion
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05152  Tuberculosis
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100171605 (RHOA)
   04015 Rap1 signaling pathway
    100171605 (RHOA)
   04310 Wnt signaling pathway
    100171605 (RHOA)
   04350 TGF-beta signaling pathway
    100171605 (RHOA)
   04072 Phospholipase D signaling pathway
    100171605 (RHOA)
   04071 Sphingolipid signaling pathway
    100171605 (RHOA)
   04024 cAMP signaling pathway
    100171605 (RHOA)
   04022 cGMP-PKG signaling pathway
    100171605 (RHOA)
   04150 mTOR signaling pathway
    100171605 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100171605 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100171605 (RHOA)
   04520 Adherens junction
    100171605 (RHOA)
   04530 Tight junction
    100171605 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100171605 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100171605 (RHOA)
   04621 NOD-like receptor signaling pathway
    100171605 (RHOA)
   04625 C-type lectin receptor signaling pathway
    100171605 (RHOA)
   04660 T cell receptor signaling pathway
    100171605 (RHOA)
   04670 Leukocyte transendothelial migration
    100171605 (RHOA)
   04062 Chemokine signaling pathway
    100171605 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100171605 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    100171605 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100171605 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    100171605 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100171605 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    100171605 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171605 (RHOA)
   05206 MicroRNAs in cancer
    100171605 (RHOA)
   05205 Proteoglycans in cancer
    100171605 (RHOA)
   05203 Viral carcinogenesis
    100171605 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100171605 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100171605 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100171605 (RHOA)
   05135 Yersinia infection
    100171605 (RHOA)
   05133 Pertussis
    100171605 (RHOA)
   05152 Tuberculosis
    100171605 (RHOA)
   05100 Bacterial invasion of epithelial cells
    100171605 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100171605 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100171605 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100171605 (RHOA)
   04031 GTP-binding proteins [BR:pon04031]
    100171605 (RHOA)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100171605 (RHOA)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100171605 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   100171605 (RHOA)
  Exosomal proteins of colorectal cancer cells
   100171605 (RHOA)
  Exosomal proteins of bladder cancer cells
   100171605 (RHOA)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100171605 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 100171605
NCBI-ProteinID: NP_001124755
UniProt: Q5REY6
LinkDB
Position
3
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGRLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggaaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag
aactatgtggcagatatcgaggtggatggaaagcaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcctgaggcccctctcctacccagatactgatgttata
ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaagtggacc
ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa
cctgaagaaggcagagatatggcaaataggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa
gctagacgtgggaagaaaaaatctgggcgccttgtcctgtga

DBGET integrated database retrieval system