KEGG   Pongo abelii (Sumatran orangutan): 100171682
Entry
100171682         CDS       T01416                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma
  KO
K08526  retinoid X receptor gamma
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03320  PPAR signaling pathway
pon04659  Th17 cell differentiation
pon04919  Thyroid hormone signaling pathway
pon04920  Adipocytokine signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05216  Thyroid cancer
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100171682 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100171682 (RXRG)
   03320 PPAR signaling pathway
    100171682 (RXRG)
   04919 Thyroid hormone signaling pathway
    100171682 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    100171682 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100171682 (RXRG)
   05202 Transcriptional misregulation in cancer
    100171682 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    100171682 (RXRG)
   05216 Thyroid cancer
    100171682 (RXRG)
   05222 Small cell lung cancer
    100171682 (RXRG)
   05223 Non-small cell lung cancer
    100171682 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100171682 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pon03310]
    100171682 (RXRG)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100171682 (RXRG)
Nuclear receptors [BR:pon03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100171682 (RXRG)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100171682
NCBI-ProteinID: NP_001124824
Ensembl: ENSPPYG00000000571
UniProt: Q5REL6 A0A2J8SL66
LinkDB
Position
1
AA seq 463 aa
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccgcaggctatggaggctcccctggc
cacactggctctacatccatgagcccatcagcagccttgtccacagggaagccaatggac
agccaccccagctacacggataccccagtgagtgccccacggactctgagtgcagtgggg
acccccctcaatgccctgggctctccatatcgagtcatcacctctgctatgggcccaccc
tcaggagcactggcagcgcctccaggaatcaacttggttgccccacccagctctcagcta
aatgtggtcaacagtgtcagcagttcagaggacatcaagcccttaccagggcttcccggg
attggaaacatgaactacccatccaccagccctggatctctggttaaacacatctgtgcc
atctgtggagacagatcctcaggaaagcactacggggtatacagttgtgaaggctgcaaa
gggttcttcaagaggacgataaggaaggacctcatctacacgtgtcgggataataaagac
tgcctcattgacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaagacagagaagccgagagcgagcc
gagagtgaggcagaatgtgccagtagtggtcatgaagacatgcctgtggagaggattcta
gaagctgaacttgctgttgaaccaaagacagaatcctatggtgacatgaacatggagaac
tcgacaaatgaccctgttaccaacatatgtcatgctgctgacaagcagcttttcaccctc
gttgaatgggccaagcgtattccccacttctctgacctcaccttggaggaccaggtcatt
ttgcttcgggcagggtggaatgaattgctgattgcctctttctcccaccgctcagtttcc
gtgcaggatggcatccttctggccacgggtttacatgtccacaggagcagtgcccatagt
gctggggtcggctccatctttgacagagttctaactgagctggtttccaaaatgaaagac
atgcagatggacaagtcggagctggggtgcctgcgagccattgtgctctttaacccagat
gccaagggcctgtccaacccctctgaagtggagactctgcgagagaaggtttatgccacc
cttgaggcctacaccaagcagaagtatccagaacagccaggcaggtttgccaagctgctg
ctgcgcctcccagctctgcgctccattggcttgaaatgcctggagcacctcttcttcttc
aagctcatcggggacacccccattgacaccttcctcatggagatgttggagaccccgctg
cagatcacctga

KEGG   Pongo abelii (Sumatran orangutan): 100460920
Entry
100460920         CDS       T01416                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X2
  KO
K08525  retinoid X receptor beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03320  PPAR signaling pathway
pon04659  Th17 cell differentiation
pon04919  Thyroid hormone signaling pathway
pon04920  Adipocytokine signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05216  Thyroid cancer
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100460920 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100460920 (RXRB)
   03320 PPAR signaling pathway
    100460920 (RXRB)
   04919 Thyroid hormone signaling pathway
    100460920 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    100460920 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460920 (RXRB)
   05202 Transcriptional misregulation in cancer
    100460920 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100460920 (RXRB)
   05216 Thyroid cancer
    100460920 (RXRB)
   05222 Small cell lung cancer
    100460920 (RXRB)
   05223 Non-small cell lung cancer
    100460920 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100460920 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pon03310]
    100460920 (RXRB)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100460920 (RXRB)
Nuclear receptors [BR:pon03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100460920 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 100460920
NCBI-ProteinID: XP_002809190
UniProt: A0A2J8Y2U6
LinkDB
Position
6
AA seq 532 aa
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAVAGGEQQTP
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPP
PPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKP
PVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSC
RDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPV
DRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFS
SLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVL
TELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPE
QQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtcttgggccgctcgcccgcccttcctccctcagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatcccgcggcggcggcggcggcggtggcaggcggagaacaacaaaccccg
gagccggagccgggggaggctggacgggacgggatgggcgacagcgggcgggactcccga
agcccagacagctcctccccaaatccccttccccagggagtccctcccccttctcctcct
gggccacccctacccccttcaacagctccatcccttggaggctctggggccccaccccca
cccccgatgccaccacccccactgggctctccctttccagtcatcagttcttccatgggg
tcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagcccccag
attaactcaacagtgtcactccctgggggtgggtctggcccccctgaagatgtgaagcca
ccagtcttaggggtccggggcctgcactgtccaccccctccaggtggccctggggctggc
aaacggctatgtgcaatctgcggggacagaagctcaggcaaacactacggggtttacagc
tgtgagggttgcaagggcttcttcaaacgcaccatccgcaaggaccttacatactcttgc
cgggacaacaaagactgcacagtggacaagcgccagcggaaccgctgtcagtactgccgc
tatcagaagtgcctggccactggcatgaagagggaggcagtacaggaggagcgtcagcgg
ggaaaggacaaggatggggatggggagggggctgggggagccccggaggagatgcctgtg
gacaggatcctggaggcagagcttgctgtggaacagaagagtgaccagggcgttgagggt
cctgggggaaccgggggtagcggcagcagtccaaatgacccggtgactaacatctgtcag
gcagctgacaaacagctattcacgcttgttgagtgggcgaagaggatcccacacttttcc
tccttgcctctggatgatcaggtcatattgctgcgggcaggctggaatgaactcctcatt
gcctccttctcacaccgatccattgatgttcgagatggcatcctccttgccacaggtctt
cacgtgcaccgcaactcagcccattcagcaggagtaggagccatctttgatcgggtgctg
acagagctagtgtccaaaatgcgtgacatgaggatggacaagacagagcttggctgcctg
agggcaatcattctgtttaatccagatgccaagggcctctccaaccctagtgaggtggag
gtcctgcgggagaaagtgtatgcatcactggagacctactgcaaacagaagtaccctgag
cagcagggacggtttgccaagctgctgctacgtcttcctgccctccggtccattggcctt
aagtgtctagagcatctgtttttcttcaagctcattggtgacacccccatcgacaccttc
ctcatggagatgcttgaggctccccatcaactggcctga

DBGET integrated database retrieval system