KEGG   Pongo abelii (Sumatran orangutan): 100171905
Entry
100171905         CDS       T01416                                 

Gene name
NRG1
Definition
(RefSeq) pro-neuregulin-1, membrane-bound isoform
  KO
K05455  neuregulin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04012  ErbB signaling pathway
pon05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100171905 (NRG1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100171905 (NRG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100171905 (NRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100171905 (NRG1)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100171905 (NRG1)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100171905 (NRG1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100171905 (NRG1)
SSDB
Other DBs
NCBI-GeneID: 100171905
NCBI-ProteinID: NP_001125025
UniProt: Q5RDM9
LinkDB
Position
8
AA seq 96 aa
MEIYSPDMSEVAAERSSSPSTQLSADPSLDGLPAAEDMPEPQTEDGRTPGLVGLAVPCCA
CLEAERLRGCLNSEKICIVPILACLVSLCLCIAGLK
NT seq 291 nt   +upstreamnt  +downstreamnt
atggagatttattccccagacatgtctgaggtcgccgccgagaggtcctccagcccctcc
actcagctgagtgcagacccatctcttgatgggcttccggcagcagaagacatgccagag
ccccagactgaagatgggagaacccctggactcgtgggcctggccgttccctgctgtgcg
tgcctagaagctgagcgcctgagaggttgcctcaactcagagaaaatctgcattgtcccc
atcctggcttgcctggtcagcctctgcctctgcatcgccggcctcaagtga

DBGET integrated database retrieval system