KEGG   Pongo abelii (Sumatran orangutan): 100171913
Entry
100171913         CDS       T01416                                 

Gene name
ITGB6
Definition
(RefSeq) integrin beta-6
  KO
K06589  integrin beta 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100171913 (ITGB6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100171913 (ITGB6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100171913 (ITGB6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100171913 (ITGB6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100171913 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100171913 (ITGB6)
   05414 Dilated cardiomyopathy
    100171913 (ITGB6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100171913 (ITGB6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100171913 (ITGB6)
   04515 Cell adhesion molecules [BR:pon04515]
    100171913 (ITGB6)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100171913 (ITGB6)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin beta subunits
   100171913 (ITGB6)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 100171913
NCBI-ProteinID: NP_001125033
Ensembl: ENSPPYG00000012877
UniProt: Q5RDL9
LinkDB
Position
2B
AA seq 715 aa
MITYKVAVPWEVQKPVKTACLLDLSVPGVLRRILPVHLELAKGGAQTLQVHVRQTEDYPV
DLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEI
ANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCK
EKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIG
QLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRS
EVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFNVTVNIPNCERRSRHI
IIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRCECG
EDILSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCMRHKGLLCG
GNGDCDCGECVCRSGWTGEYCNCTTSTDSCISEDGVLCSGRGDCVCGKCVCTNPGASGPT
CERCPTCGDPCNSKRSCIECHLSAAGQAQEECVDKCKLAGATISEEEDFSKDGSVSCSLQ
GENECLITFLITTDNEGKTIIHSINEKDCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLL
VSFHDRKEVAKFEAERSKVKWQTGTNPLYRGSTSTFKNVTYKHREKQKVDLSTDC
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgatcacgtacaaggtggctgtgccctgggaggtgcagaaacctgtgaagactgcctgc
ttattggacctcagtgtgcctggtgtgctcaggagaattttacccgtccatctggagttg
gcgaaaggtggtgcgcagactctgcaggtgcatgtccgccagactgaggactacccggtg
gatttgtattacctcatggacctctctgcctccatggatgatgacctcaacacaatcaag
gagctgggctcccggctttccaaagagatgtctaaattaaccagcaactttagactgggc
tttggatcttttgtagaaaaacctgtatccccttttgtgaaaacaacaccggaagaaatt
gccaacccttgcagtagtattccatacttctgtttacctacatttggattcaagcatatt
ttgccattgacaaatgatgctgaaagattcaatgaaattgtgaagaatcagaaaatttct
gctaatattgacacacccgaaggtggatttgatgcaattatgcaagctgctgtgtgtaag
gaaaaaattggctggcggaatgactccctccacctcctggtctttgtgagtgatgctgat
tctcattttggaatggacagcaaactagcaggcatcgtcattcctaatgacgggctctgt
cacttggacagcaagaatgaatactccatgtcaactgtcttggaatatccaacaattgga
caactcattgataaactggtacaaaacaatgtgttattgatcttcgctgtaacccaagaa
caagttcatttatatgagaattacgcaaaacttattcctggagctacagtagggctactt
cagaaggactccggaaacattctccagctgatcatctcagcttatgaagaactgcggtct
gaggtggaactggaagtattaggagacactgaaggactcaacttgtcatttacagccatc
tgtaacaacggtaccctcttccaacaccaaaagaaatgctctcacatgaaagtgggagac
acagcttccttcaacgtgactgtgaatatcccaaactgcgagagaagaagcaggcacatt
atcataaagcctgtggggctgggggacgccctggaattacttgtcagtccagaatgcaac
tgcgactgtcagaaagaagtggaagtgaacagctccaaatgtcaccatgggaacggctcc
ttccagtgtggggtgtgtgcctgccaccctggccacatggggcctcgctgtgagtgtggc
gaggacatactgagcacagattcctgcaaggaggccccagatcatccctcctgcagcgga
aggggtgactgctactgtgggcagtgtatctgccacttgtctccctatggaaacatttat
gggccttattgccagtgtgacaatttctcctgcatgagacacaaagggctgctctgcgga
ggtaacggcgactgtgactgtggtgaatgtgtgtgcaggagtggctggactggcgagtac
tgcaactgcaccaccagcacggactcctgcatctctgaagacggagtgctctgcagtggg
cgcggggactgtgtttgtggcaagtgtgtttgcacaaaccctggagcctcaggaccaacc
tgtgaacgatgtcctacctgtggtgacccctgtaactctaaacggagctgcattgaatgc
cacctgtcagcagctggccaagcccaagaagaatgtgtggacaagtgcaaactagctggt
gcgaccatcagtgaagaagaagatttctcaaaggatggttctgtttcctgctctctgcaa
ggagaaaatgaatgtcttattacattcctaataactacagataatgaggggaaaaccatc
attcacagtatcaatgaaaaagattgtccgaagcctccaaacattcccatgatcatgtta
ggggtttccctggctattcttctcatcggggttgtcctactgtgcatctggaagctactg
gtgtcatttcatgatcgtaaagaagttgccaaatttgaagcagaacgatcaaaagtcaag
tggcaaacgggaaccaatccactctacagaggctccacaagtacttttaaaaatgtaact
tataaacacagggaaaaacaaaaggtagacctttccacagattgctag

KEGG   Pongo abelii (Sumatran orangutan): 100172223
Entry
100172223         CDS       T01416                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 precursor
  KO
K05719  integrin beta 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04360  Axon guidance
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules
pon04530  Tight junction
pon04611  Platelet activation
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05145  Toxoplasmosis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100172223 (ITGB1)
   04151 PI3K-Akt signaling pathway
    100172223 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100172223 (ITGB1)
   04514 Cell adhesion molecules
    100172223 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100172223 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100172223 (ITGB1)
   04530 Tight junction
    100172223 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100172223 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100172223 (ITGB1)
   04670 Leukocyte transendothelial migration
    100172223 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    100172223 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172223 (ITGB1)
   05205 Proteoglycans in cancer
    100172223 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100172223 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100172223 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100172223 (ITGB1)
   05414 Dilated cardiomyopathy
    100172223 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100172223 (ITGB1)
   05133 Pertussis
    100172223 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    100172223 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100172223 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100172223 (ITGB1)
   05140 Leishmaniasis
    100172223 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100172223 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100172223 (ITGB1)
   04515 Cell adhesion molecules [BR:pon04515]
    100172223 (ITGB1)
   04090 CD molecules [BR:pon04090]
    100172223 (ITGB1)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100172223 (ITGB1)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100172223 (ITGB1)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin beta subunits
   100172223 (ITGB1)
CD molecules [BR:pon04090]
 Proteins
  100172223 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 100172223
NCBI-ProteinID: NP_001125324
UniProt: Q5RCA9
LinkDB
Position
10
AA seq 798 aa
MNLQPIFWIGLISSICCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPVKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGRRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAGHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacaaccgattttctggattggactgatcagttcaatttgctgtgtgtttgct
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcctact
tctgcacgctgtgatgatttagaagccttaaaaaagaagggttgtcctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcccattgacctctactaccttatggacctgtcttactcaatgaaagacgatttggag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttcggacttc
agaattggatttggctcatttgtggaaaagactgtgatgccttacattagcacaacacca
gttaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtcttactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggttttgatgccatcatgcaagttgcagtt
tgtggatcactgattggccggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacaa
tgtcacctggaaaataatatgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacgatttttgcagttactgaagaa
tttcagcctgtttacaaggagctgaaaaacttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacagcaaattgtcagaaggagtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aacgggacatttgagtgtggagcgtgcaggtgcaatgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggacgcttactgcaggaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtctgcggacagtgtgtttgtaggaag
agggacaatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcatgtgactgttctttggatactagtacttgtgaa
gccagcaacggacagatctgcaatggccggggcatctgcgagtgtggtgtctgtaagtgt
acagatccgaagtttcaagggcaaacgtgtgagatgtgtcagacctgccttggtgtctgt
gctgggcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcacacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccagtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacgtattcagtgaatgggaacaacgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgataattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgccgtgacaactgtggtcaatccaaagtatgagggaaaatga

KEGG   Pongo abelii (Sumatran orangutan): 100440010
Entry
100440010         CDS       T01416                                 

Gene name
ITGB7
Definition
(RefSeq) integrin beta-7
  KO
K06590  integrin beta 7
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules
pon04672  Intestinal immune network for IgA production
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05202  Transcriptional misregulation in cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100440010 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100440010 (ITGB7)
   04514 Cell adhesion molecules
    100440010 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100440010 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100440010 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100440010 (ITGB7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100440010 (ITGB7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100440010 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100440010 (ITGB7)
   05414 Dilated cardiomyopathy
    100440010 (ITGB7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100440010 (ITGB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100440010 (ITGB7)
   04515 Cell adhesion molecules [BR:pon04515]
    100440010 (ITGB7)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100440010 (ITGB7)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin beta subunits
   100440010 (ITGB7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 100440010
NCBI-ProteinID: XP_024112442
Ensembl: ENSPPYG00000004571
LinkDB
Position
12
AA seq 798 aa
MVTLPVVLVLLLVLSRGESELDAKIPSTGDATERRNPHLSLLGSCQPASSCQKCILSHPS
CAWCKQLNFTALGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
GLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQSQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGELCSGHGRCKCNRCQCSDGYYGALCDQCPGCKTPCERHRDCAECGAFGTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGRVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggtgactttgccagtggtccttgttttgctgctggtcctgagcagaggtgagagtgaa
ttggatgccaagatcccatccacaggggatgccacagaacggcggaatcctcacctgtcc
ctgctggggtcctgccagccagcctcctcctgccagaagtgcatcctctcacaccccagc
tgcgcatggtgcaagcaactgaacttcaccgcgttgggggaggcggaggcgcggcgctgc
gcccgacgagaggagctgctggctcgaggctgcccgctggaggagctggaggagccccgc
ggccagcaggaggtactgcaggaccagccgctcagccagggcgcccgcggagagggtgcc
acccagctggcgccgcagcgggtccgggtcacgctgcggcctggggagccccagcagctc
caggtccgcttccttcgtgctgagggatacccggtggacctgtactaccttatggacctg
agctactccatgaaggacgacctggaacgcgtgcgccagctcgggcacgctctgctggtc
gggctgcaggaagtcacccattctgtgcgcattggttttggttcctttgtggacaaaacg
gtgctgccctttgtgagcacagtaccctccaagctgcgccacccctgccccacccggctg
gagcgctgccagtcacccttcagctttcaccatgtgctgtccctaacgggggacgcgcaa
gccttcgagcgggaggtggggcgccagagtgtgtccggcaatctggactcccctgaaggt
ggcttcgatgccattctgcaggctgcactctgccaggagcagattggctggagaaatgtg
tcccggctgctggtgttcacttcagacgacacatttcatacagctggggacgggaagttg
ggcggcattttcatgcccagtgatgggcactgccacttggacagcaatggcctctacagt
cgcagcacagagtttgactacccttctgtgggtcaggtagcccaggccctctctgcagca
aacatccagcccatctttgctgtcaccagtgccgcactgcctgtctaccaggagctcagt
aagctgattcctaagtctgcagttggggagctgagtgaggactccagcaacgtggtacag
ctcatcatggatgcttataatagcctgtcttccaccgtgacccttgaacactcttcactc
cctcctggggtccacatttcttatgaatcccagtgtgagggtcctgagaagagggagggt
aaggctgaggatcgaggacagtgcaaccacgtccgaatcaaccagacggtgactttctgg
gtttctctccaagccacccactgcctcccagagccccatctcctgaggctccgggccctt
ggcttctcagaggagctgattgtggagttgcacacactgtgtgactgtaattgcagtgac
acccagtcccaggctccccactgcagtgatggccagggacacctacaatgtggggtatgc
agctgtgcccctggccgcctaggtcggctctgtgagtgctctgtggctgagctgtcctcc
ccagacctggaatctgggtgccgggctcccaatggcacagggcccctgtgcagtggaaag
ggtcactgtcaatgtggacgctgcagctgcagtggacagagttctgggcatctgtgcgag
tgtgacgatgccagctgtgagcgacatgagggcatcctctgtggaggctttggtcgctgc
caatgtggagtatgtcactgtcatgccaaccgcacgggcagagcatgcgaatgcagtggg
gacatggacagttgcatcagtcccgagggagagctctgcagtgggcatggacgctgcaaa
tgcaaccgctgccagtgctcggacggttactatggtgctctatgcgaccaatgcccaggc
tgcaagacaccatgtgagagacaccgggactgtgcagagtgtggggccttcgggactggc
ccactggccaccaactgcagtacagcttgtgcccataccaatgtgaccctggccttggcc
cctatcttggatgatggctggtgcaaagagaggaccctggacaaccagctgttcttcttc
ttggtggaggatgatgccagaggcagggttgtgctcagagtgagaccccaagaaaaggga
gcagaccacacccaggccattgtgctgggttgcgtagggggcatcgtggcagtggggctg
gggctggtcctggcttaccggctctcggtggaaatctatgaccgccgggaatacagtcgc
tttgagaaggagcagcaacaactcaactggaagcaggacagtaatcctctctacaaaagt
gccatcacgaccaccatcaatcctcgctttcaagaggcagacagtcccactctctga

KEGG   Pongo abelii (Sumatran orangutan): 100445345
Entry
100445345         CDS       T01416                                 

Gene name
ITGB3
Definition
(RefSeq) integrin beta-3
  KO
K06493  integrin beta 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04640  Hematopoietic cell lineage
pon04810  Regulation of actin cytoskeleton
pon04919  Thyroid hormone signaling pathway
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05168  Herpes simplex virus 1 infection
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100445345 (ITGB3)
   04151 PI3K-Akt signaling pathway
    100445345 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100445345 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100445345 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100445345 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100445345 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100445345 (ITGB3)
   04611 Platelet activation
    100445345 (ITGB3)
   04613 Neutrophil extracellular trap formation
    100445345 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100445345 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100445345 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100445345 (ITGB3)
   05205 Proteoglycans in cancer
    100445345 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100445345 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    100445345 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100445345 (ITGB3)
   05414 Dilated cardiomyopathy
    100445345 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100445345 (ITGB3)
   05163 Human cytomegalovirus infection
    100445345 (ITGB3)
   05165 Human papillomavirus infection
    100445345 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100445345 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100445345 (ITGB3)
   04515 Cell adhesion molecules [BR:pon04515]
    100445345 (ITGB3)
   04090 CD molecules [BR:pon04090]
    100445345 (ITGB3)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100445345 (ITGB3)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100445345 (ITGB3)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin beta subunits
   100445345 (ITGB3)
CD molecules [BR:pon04090]
 Proteins
  100445345 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 100445345
NCBI-ProteinID: XP_002834363
LinkDB
Position
17
AA seq 788 aa
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCHQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCALESIEFPVSEARVLEDRPLSNKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT
NT seq 2367 nt   +upstreamnt  +downstreamnt
atgcgagcgcggccgcggccccggccgctctgggcgactgtgctggcgctgggggcgctg
gcgggcgttggcgtcggagggcccaacatctgtaccacgcgaggtgtgagctcctgccat
cagtgcctggctgtgagccccatgtgtgcctggtgctctgatgaggccctgcctctgggc
tcacctcgctgtgacctgaaggagaatctgctgaaggataactgtgccctggaatccatc
gagttcccagtgagtgaggcccgagtactagaggacaggcccctcagcaacaagggctct
ggagacagctcccaggtcactcaagtcagtccccagaggattgcactccggctccggcca
gatgattcgaagaatttctccatccaagtgcggcaggtggaggattaccctgtggacatc
tactacttgatggacctgtcttactccatgaaggatgatctgtggagcatccagaacctg
ggtaccaagctggccacccagatgcgaaagctcaccagtaacctgcggattggcttcggg
gcatttgtggacaagcctgtgtcaccatacatgtatatctccccaccagaggccctcgaa
aacccctgctatgatatgaagaccacctgcttgcccatgtttggctacaaacacgtgctg
acgctcactgaccaggtgacccgcttcaatgaggaagtgaagaagcagagtgtgtcacgg
aaccgagatgccccagagggtggctttgatgctatcatgcaggctacagtctgtgatgaa
aagattggctggaggaatgacgcatcccacttgctggtgtttaccactgatgccaagact
catatagcactggacggaaggctggcaggcattgtccagcccaatgatgggcagtgtcat
gttggtagtgacaatcattactctgcctccactaccatggattatccctctttggggctg
atgactgagaagctatcccagaaaaacatcaatttgatctttgcagtgactgaaaatgta
gtcaatctctatcagaactatagtgagctcatcccagggaccacagtcggggttctgtcc
atggattccagcaatgtcctccagctcattgtcgatgcttatgggaaaatccgctctaaa
gtcgagctggaagtgcgtgacctccctgaagagttgtctctatccttcaatgccacctgc
ctcaacaatgaggtcatccctggcctcaagtcttgtatgggactcaagattggagacacg
gtgagcttcagcattgaggccaaagtgcgaggctgtccccaggagaaggagaagtccttt
accatcaagcccgtgggcttcaaggacagcctgatcgtccaggtcacctttgattgtgac
tgtgcctgccaggcccaagctgaacctaatagccatcgctgcaacaatggcaatgggacc
tttgagtgtggggtatgccgttgtgggcctggctggctgggatcccagtgtgagtgctca
gaggaggactatcgcccttcccagcaggacgagtgcagcccccgggagggtcagcccgtc
tgcagccagcggggcgagtgcctctgtggtcagtgtgtctgccacagcagtgactttggc
aagatcacgggcaagtactgcgagtgtgatgacttctcctgtgtccgctacaagggggag
atgtgctcaggccatggccagtgcagctgtggggactgcctgtgtgactctgactggacc
ggctactactgcaactgtaccacacgtactgacacctgcatgtccagcaatgggctgctg
tgcagcggccgcggcaagtgtgaatgtggcagctgtgtctgtatccagccaggctcctat
ggggacacctgtgagaagtgccccacctgcccagatgcctgcacctttaagaaagaatgt
gtggagtgtaagaagtttgatcggggagccctacatgacgaaaatacctgcaaccgttac
tgccgtgatgagattgagtcagtgaaagagcttaaggacactggcaaggatgcagtgaat
tgtacctataagaatgaggatgactgtgtcgtcagattccagtactatgaagattctagt
ggaaagtccatcctgtatgtggtagaagagccagagtgtcccaagggccctgacatcctg
gtggtcctgctctcagtgatgggggccattctgctcatcggccttgccgctctgctcatc
tggaagctcctcatcaccatccacgaccgaaaagagttcgctaaatttgaggaagaacgc
gccagagcaaaatgggacacagccaacaacccactgtataaagaggccacatctaccttc
accaatatcacgtaccggggcacttaa

KEGG   Pongo abelii (Sumatran orangutan): 100449826
Entry
100449826         CDS       T01416                                 

Gene name
ITGB5
Definition
(RefSeq) integrin beta-5
  KO
K06588  integrin beta 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05205  Proteoglycans in cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100449826 (ITGB5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100449826 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100449826 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100449826 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100449826 (ITGB5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100449826 (ITGB5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100449826 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100449826 (ITGB5)
   05414 Dilated cardiomyopathy
    100449826 (ITGB5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100449826 (ITGB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100449826 (ITGB5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pon04515]
    100449826 (ITGB5)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100449826 (ITGB5)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin beta subunits
   100449826 (ITGB5)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2 DUF2975
Other DBs
NCBI-GeneID: 100449826
NCBI-ProteinID: XP_024100765
Ensembl: ENSPPYG00000013466
LinkDB
Position
3
AA seq 799 aa
MPRAPAPLYACLLGLCALLPRLAGLNICTSGSASSCEECLLIHPKCSWCFKEDFGSPRSI
TSRCDLRANLVRNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TASFEVSVEARSCPSRHTEHVFSLRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCSGSG
TYVCGLCECNPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNA
MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgccgcgggccccggcgccgctgtacgcctgcctcctggggctctgcgcgctcctgccc
cggctggcaggtctcaacatatgcactagtggaagtgccagctcatgtgaagaatgtctg
ctaatccacccaaaatgttcctggtgcttcaaagaggacttcggaagcccacggtccatc
acctctcggtgtgacttgagggcaaaccttgtcagaaatggctgtggaggtgagatagag
agcccagccagcagcttccatgtcctgaggagcctgcccctcagcagcaagggttcgggc
tctgcaggctgggacgtcattcagatgacaccacaggagattgccgtgaacctccggccc
ggtgacaagaccaccttccagctacaggttcgccaggtggaggactatcctgtggacctg
tactacctgatggacctctccctgtccatgaaggatgacttggacaatatccggagcctg
ggcaccaaactcgcggaggagatgaggaagctcaccagcaacttccgtttgggatttggg
tcttttgttgataaggacatctctcctttctcctacacagcaccgaggtaccagaccaat
ccatgcattggttacaagttgtttccaaattgcgtcccctcctttgggttccgccatctg
ctgcctctcacagacagagtggacagcttcaatgaggaagttcggaaacagagggtgtcc
cggaaccgagatgcccctgaggggggctttgatgcagtactccaggcagccgtctgcaag
gagaagattggctggcgaaaggatgcactgcatttgctggtgttcacaacggatgatgtg
ccccacattgcattggatggaaaattgggaggtctggtgcagccacatgatggccagtgc
cacctgaacgaggccaacgagtacactgcatctaaccagatggactatccatcccttgcc
ttgcttggagagaaactggcagagaacaacatcaacctcatctttgcagtgacgaaaaac
cattatatgctgtacaagaattttacagccctgatacctggaacaacggtggagatttta
gacggagactccaaaaatattattcaactgattattaatgcatacaatagtatccggtct
aaagtggagctgtcggtctgggatcagcctgaggatcttaatctcttctttactgctacc
tgccaagatggggtatcctatcctggtcagaggaagtgtgagggcctgaagattggggac
acggcatcttttgaggtatcagtggaggcccgaagctgtcccagcagacacacggagcac
gtgttttccctgcggccggtgggattccgggacagcctggaggtgggggtcacctacaac
tgcacgtgcggctgcagcgtggggctggaacccaacagcgccaggtgcagcgggagcggg
acctatgtctgcggcctgtgtgagtgcaaccccggctacctgggcaccaggtgcgagtgc
caggatggggagaaccagagtgtgtaccagaacctgtgccgggaggcagagggcaagcca
ctgtgcagcgggcgcggggactgcagctgcaaccagtgctcctgcttcgagagcgagttc
ggcaagatctacgggcctttctgtgagtgcgacaacttctcctgtgccaggaacaaggga
gtcctctgctcaggccatggcgagtgtcactgcggggaatgcaagtgccatgcaggttac
atcggggacaactgtaactgctcgacagacatcagcacgtgccggggcagagatggccag
atctgcagcgagcgtgggcactgtctctgtgggcagtgccaatgcacggagccgggggcc
tttggggagatgtgtgagaagtgccccacctgcccggatgcgtgcagcaccaagagagat
tgtgtcgagtgcctgctgctccactctgggaaacctgacaaccagacctgccacagcctg
tgcagggatgaggtgatcacatgggtggacaccatcgtgaaagatgaccaggaggctgtg
ctttgtttctacaaaaccgccaaggactgcgtcatgatgttcacctatgtggagctcccc
agtgggaagtccaacctgacggtcctcagggagccagagtgtggaaacacccccaacgcc
atgaccatcctcctggctgtggtcggtagcatcctccttgttgggctcgcactcctggct
atctggaagctgcttgtcaccatccatgaccggagggagtttgcaaagttccagagcgag
cgatccagggcccgctacgaaatggcttcaaacccattgtacagaaagcctatctccaca
cacactgtggacttcaccttcaacaaattcaacaaatcctacaatggcactgtggactga

KEGG   Pongo abelii (Sumatran orangutan): 100453768
Entry
100453768         CDS       T01416                                 

Gene name
ITGB4
Definition
(RefSeq) integrin beta-4 isoform X1
  KO
K06525  integrin beta 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100453768 (ITGB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100453768 (ITGB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100453768 (ITGB4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100453768 (ITGB4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100453768 (ITGB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100453768 (ITGB4)
   05414 Dilated cardiomyopathy
    100453768 (ITGB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100453768 (ITGB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100453768 (ITGB4)
   04515 Cell adhesion molecules [BR:pon04515]
    100453768 (ITGB4)
   04090 CD molecules [BR:pon04090]
    100453768 (ITGB4)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100453768 (ITGB4)
  Exosomal proteins of bladder cancer cells
   100453768 (ITGB4)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin beta subunits
   100453768 (ITGB4)
CD molecules [BR:pon04090]
 Proteins
  100453768 (ITGB4)
SSDB
Motif
Pfam: Integrin_beta fn3 Calx-beta Integrin_B_tail I-EGF_1 PSI_integrin Pur_ac_phosph_N EGF_2 SEA
Other DBs
NCBI-GeneID: 100453768
NCBI-ProteinID: XP_024091018
Ensembl: ENSPPYG00000008634
LinkDB
Position
17
AA seq 1752 aa
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR
CNTQAELLAAGCQRENIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEEQHFEL
EVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDERCHLDATGTYTQYR
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTKTGSFHIRRGEVGVYQVQLRALEHVDG
THVCQLPEDQKGNIHLKPSFSDGLKMDVGIICDVCTCELRKEVRSARCSFNGDFMCGHCV
CSEGWSGQTCNCSTGSLSDIQPCLREDEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDN
FQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGR
CHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDE
LKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLL
LLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLR
SGSLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTREC
AQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLK
LTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDEEKQL
LVEAIDVPAGTATLGRRLVNITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGG
KSQVSYRTQDGTAQGNRDYIPMEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVRRFH
VQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGS
RKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYG
AEGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQP
KRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTEHLVNGRMDFA
FPGSTNSLHGMTTTSTAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEHSHSTTLPRDY
STLTSVSSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLNGG
ELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCP
LPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIIGYLVTCEMAQGGGPATTF
RVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSHAG
LFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGT
LSTQVDQQFFQT
NT seq 5259 nt   +upstreamnt  +downstreamnt
atggcagggccacgccccagcccatgggccaggctgctactggcagccttgatcagcgtc
agcctctctgggaccttggcaaaccgctgcaagaaggccccagtgaagagctgcacggag
tgtgtccgtgtggataaggactgcgcctactgcacggacgagatgttcagggaccggcgc
tgcaacacccaggcggagctgctggccgcgggctgccagcgggagaacatcgtggtcatg
gagagcagcttccagatcacagaggagacccagattgacaccaccctgcggcgcagccag
atgtccccccagggcctgcgggtccgtctgcggcccggtgaggagcagcactttgagctg
gaggtgtttgagcccctggagagccctgtggacctgtacatcctcatggacttctccaac
tccatgtccgatgatctggacaacctcaagaagatggggcagaacctggctcgggtcctg
agccagctcaccagcgactacactattggatttggcaagtttgtggacaaagtcagcgtc
ccgcagacggacatgaggcctgagaagctgaaggagccctggcccaacagtgaccccccc
ttctccttcaagaacgtcatcagcctgacagaagatgtggatgagttccggaataaactg
cagggagagcggatctcaggcaacctggatgctcctgagggcggcttcgatgccatcctg
cagacggccgtgtgcacgagggacattggctggcgcccagacagcacccacctgctggtc
ttctccaccgagtcagccttccactatgaggccgacggcgccaacgtgctggctggcatc
atgagccgcaacgatgaacggtgccacctggatgccacgggcacctacacccagtacagg
acacaggactacccgtcggtgcccaccctggtgcgcctgctcgccaagcacaacatcatc
cccatttttgctgtcaccaactactcctatagctactacgagaagcttcacacctatttc
cctgtctcctcgctgggggtgctgcaggaggactcgtccaacatcgtggagctgctggag
gaggccttcaatcgaatccgctccaacctggacatccgggccctagacagcccccgaggc
cttcggacagaggtcacctccaagatgttccagaagacgaagactgggtcctttcacatc
cggcggggggaagtgggtgtataccaggtgcagctgcgggccctcgagcacgtggatggg
actcatgtgtgccagctgccggaggaccagaagggcaacatccatctgaaaccttccttc
tccgatggcctcaagatggacgtgggcatcatctgtgacgtgtgcacctgcgagctgcga
aaagaggtgcggtcagctcgctgcagcttcaacggagacttcatgtgtggacactgtgtg
tgcagtgagggctggagtggccagacctgcaactgctccaccggctctctgagtgacatt
cagccctgcctgcgggaggacgaggacaagccgtgctccggccgtggcgagtgccagtgc
gggcactgtgtgtgctacggcgaaggccgctatgagggtcagttctgcgagtatgacaac
ttccagtgtccccgcacttccgggttcctctgcaatgaccgaggacgctgctccatgggc
cagtgtgtgtgtgagcctggttggacaggcccaagctgtgactgtcccctcagcaatgcc
acctgcatcgacagcaatgggggcatctgcaatggacgtggccactgtgagtgtggccgc
tgccactgccaccagcagtcgctctacacggacaccatctgcgagatcaactactcggcg
atccacccgggcctctgcgaggacctacgctcctgcgtgcagtgccaggcgtggggcacc
ggggagaagaaggggcgcacgtgtgaggaatgcaacttcaaggtcaagatggtggacgag
cttaagagagccgaggaggtggtggtgcgctgctccttccgggacgaggatgacgactgc
acctacagctacaccatggaaggcgacggcgcccctgggcccaacagcactgtcctggtg
cacaagaagaaggactgccctccaggctccttctggtggctcatccccctgctcctcctc
ctcctgccgctcctggccctgctactgctactatgctggaagtactgcgcctgctgcaag
gcctgcctggcacttctcccttgctgcaaccgaggtcacatggtaggctttaaggaagac
cactacatgctgcgggagaacctgatggcctcagaccacctggacacacccatgctgcgt
agcgggagcctcaagggccgtgacgtggtccgctggaaggtcaccaacaacatgcaacgg
cctggctttgccactcatgctgccagcatcaaccccacagagctggtgccctacgggctg
tccttgcgcctggcccgcctttgcaccgagaacctgctgaagcccgacactcgggaatgc
gcccagctgcgccaggaggtggaggagaacctgaacgaggtctacaggcagatctccggt
gtacacaagctccagcagaccaagttccggcagcagcccaatgctgggaaaaagcaagac
cacaccattgtggacacagtgctgatggcaccccgctcggccaagccggccctgctgaag
cttacagagaagcaggtggaacagagggccttccacgacctcaaggtggcccctggctac
tacaccctcactgcagaccaggacgcccggggcatggtggagttccaggagggcgtggag
ctggtggacgtacgggtgcccctctttatccggcctgaggatgacgaggagaagcagctg
ctggtggaggccatcgatgtgcccgcgggcactgccaccctcggccgccgcctggtaaac
atcaccatcatcaaggagcaagccagagacgtggtgtcctttgagcagcctgagttctcg
gtcagccgcggggaccaggtggcccgcatccctgtcatccggcgcgtcctggatggcggg
aagtcccaggtctcctaccgcacacaggatggcaccgcgcagggcaaccgggactacatc
cccatggagggcgagctgctgttccagcctggggaggcctggaaagagctgcaggtgaag
ctcctggagctgcaagaggttgactccctcctgcggggccgccaggtccgccgtttccac
gtccagctcagcaaccctaagtttggggcccacctgggccagccccactccaccaccatc
atcatcagggacccagatgaactggaccggagcttcacgagtcagatgttgtcatcacag
ccaccccctcacggcgacctgggcgccccgcagaaccccaatgctaaggccgctgggtcc
aggaagatccatttcaactggctgcccccttctggcaagccaatggggtacagggtaaag
tactggattcagggtgactccgagtccgaagcccacctgctcgacagcaaggtgccctca
gtggagctcaccaacctgtacccgtattgcgactatgagatgaaggtgtgcgcctacggg
gctgagggcgagggaccctacagctccctggtgtcctgccgcacccaccaggaagtgccc
agcgagccagggcgtctggccttcaatgtcgtctcctccacggtgacccagctgagctgg
gctgagccagccgagaccaacggtgagatcacagcctacgaggtctgctatggcctggtc
aacgatgacaaccgacctatcgggcccatgaagaaggtgctggttgacaaccctaagaac
cggatgctgctcattgagaaccttcgggagtcccagccctaccgctacacggtgaaggcg
cgcaatggggccggctgggggcccgagcgggaggccatcatcaacctggcgacccagccc
aagaggcccatgtccatccccatcattcctgacatccctatcgtggacgcccagagcggg
gaggactacgacagcttccttatgtacagcgatgacgttctacgctctccatctggcagc
cagaggcccagcgtctccgatgacactgagcacctggtgaatggccggatggactttgcc
ttcccgggcagcaccaactccctgcatgggatgaccacgaccagcactgctgcctatggc
acccacctgagcccacacgtgccccaccgcgtgctaagcacatcctccacccttacacgg
gactacaactcgctgacccgctcggaacactcacactcgaccacactgcccagggactac
tccaccctcacctccgtctcctcccacgactctcgcctgactgctggtgtgcccgacacg
cccacccgcctggtgttctctgccctggggcccacatctctcagagtgagctggcaggag
ccgcggtgcgagcggccgctgcagggctacagcgtggagtaccagctgctgaacggcggt
gagctgcatcggctcaacatccccaaccctgcccagacctcggtggtggtagaagacctc
ctgcccaaccactcctacgtgttccgcgtgcgggcccagagccaggaaggctggggccga
gagcgtgagggcgtcatcaccattgaatcccaggtgcacccgcagagcccactctgtccc
ctgccaggctccgccttcactttgagcactcccagtgccccaggcccactggtgttcact
gccctgagcccagactcgctgcagctgagctgggagcggccacggaggcccaatggggat
atcattggctacctggtgacctgtgagatggcccaaggaggagggccagccaccacattc
cgggtggatggagacagccccgagagccggctgaccgtgccgggcctcagtgagaacgtg
ccctacaagttcaaggtgcaggccaggaccactgaaggcttcgggccagagcgcgagggc
atcatcaccatagagtcccaggatggcggacccttcccgcagctgggcagccatgccggg
ctcttccagcacccgctgcaaagcgagtacagcagcatcaccaccacccacaccagcgcc
accgagcccttcctagtggacgggctgaccctgggggcccagcacctagaggcaggtggc
tccctcacccggcatgtgacccaggagtttgtgagccggacgctgaccaccagcggaacc
ctcagcacccaggtggaccaacagttcttccaaacctga

KEGG   Pongo abelii (Sumatran orangutan): 100459025
Entry
100459025         CDS       T01416                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8
  KO
K06591  integrin beta 8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100459025 (ITGB8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100459025 (ITGB8)
   04514 Cell adhesion molecules
    100459025 (ITGB8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100459025 (ITGB8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459025 (ITGB8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100459025 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100459025 (ITGB8)
   05414 Dilated cardiomyopathy
    100459025 (ITGB8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100459025 (ITGB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100459025 (ITGB8)
   04515 Cell adhesion molecules [BR:pon04515]
    100459025 (ITGB8)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100459025 (ITGB8)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin beta subunits
   100459025 (ITGB8)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 100459025
NCBI-ProteinID: XP_002818218
Ensembl: ENSPPYG00000017749
UniProt: H2PMQ3 A0A663DDC0
LinkDB
Position
7
AA seq 769 aa
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLSQGEDNRCASSNAASCARCLA
LGPECGWCVQEDFISDGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYLNITAICPDGSRKPGMEGCR
NVTSNDEVLFNVTVTMKKCDLTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV
CSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTS
CALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSS
DYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgtgcggctcggccctggctttttttaccgctgcatttgtctgcctgcaaaacgaccgg
cgaggtcccgcctcgttcctctgggcagcctgggtgttttcacttgttcttggactgagc
caaggtgaagacaatagatgtgcatcttcaaatgcagcatcctgtgccaggtgccttgcg
ctgggtccagaatgtggatggtgtgttcaagaggatttcatttcagatggatcaagaagt
gaacgttgtgatattgtttccaatttaataagcaaaggctgctcagttgattcaatagaa
tacccatctgtgcatgttataatacccactgaaaatgaaattaatacccaggtgacacca
ggagaagtgtctatccagctgcgtccaggagctgaagctaattttatgctgaaagttcat
cctctgaagaaatatcctgtggatctttattatcttgttgatgtctcagcatcaatgcac
aataatatagaaaaattaaattccgttggaaacgatttatctagaaaaatggcatttttc
tcccgtgactttcgtcttggatttggctcatacgttgataaaacagtttcaccatacatt
agcatccaccccgaaaggattcataatcaatgcagtgactacaatttagactgcatgcct
ccccatggatacatccatgtgctgtctttgacagagaacatcactgagtttgagaaagca
gttcatagacagaagatctctggaaacatagatacaccggaaggaggttttgacgccatg
cttcaggcagctgtctgtgaaagtcatattggatggcgaaaagaggctaaaagattgctg
ctggtgatgacagatcagacatctcatcttgctcttgatagcaaattggcaggcatagtg
gtgcccaatgacggaaactgccatctgaaaaacaatgtctacgtcaaatcgacaaccatg
gaacatccctcactaggccaactttcagagaaattaatagacaacaacattaatgtcatc
tttgcagttcaaggaaaacaatttcattggtataaggatcttctacccctcttgccgggc
accattgctggtgaaatagaatcaaaggctgcaaacctcaataatttggtagtggaagcc
tatcagaagctcatttcagaagtgaaagttcaggtggaaaaccaggtacaaggcatctat
ttgaacattaccgccatctgtccagatgggtccagaaagccaggcatggaaggatgcaga
aatgtgacgagcaatgatgaagttcttttcaatgtaacagttacaatgaaaaaatgtgat
ctcacaggaggaaaaaactatgcaataatcaaacctattggttttaatgaaaccgctaaa
attcatatacacagaaactgcagctgtcagtgtgaggacaacagaggacctaaaggaaag
tgtgtagatgaaacttttctagattccaagtgtttccagtgtgatgagaataaatgtcat
tttgatgaagatcagttttcttctgagagttgcaagtcacacaaggatcaacctgtttgc
agtggtcgaggagtttgtgtttgtggcaaatgttcatgtcacaaaattaagcttggaaaa
gtgtatggaaaatactgtgaaaaggatgatttttcttgtccatatcaccatggaaatctg
tgtgctgggcatggagagtgtgaagcaggcagatgccaatgcttcagtggctgggaagga
gatcggtgccagtgcccttcagcagcagcccagcactgtgtcaattcaaagggccaagtg
tgcagtggaagaggcacgtgtgtgtgtggaaggtgtgagtgcaccgatcccaggagcatc
ggccgcttctgtgaacactgccccacctgttatacggcctgcaaggaaaattggaattgt
atgcaatgccttcaccctcacaatttgtctcaggctatacttgatcagtgcaaaacctca
tgtgctctcatggaacaacagcattatgtcgaccaaacttcagaatgtttctccagccca
agctacttgagaatatttttcatcattttcatagttacattcttgattgggttgcttaaa
gtccttatcattagacaggtgatactacaatggaatagtaacaaaattaagtcctcatca
gattacagagtgtcagcctcaaaaaaggataagttgattctgcaaagtgtttgcacaaga
gcagtaacctaccgacgtgagaagcctgaagaaataaaaatggatatcagcaaattaaat
gctcatgaaactttcaggtgcaacttctaa

DBGET integrated database retrieval system