KEGG   Pongo abelii (Sumatran orangutan): 100172156
Entry
100172156         CDS       T01416                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04144  Endocytosis
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04510  Focal adhesion
pon04520  Adherens junction
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04730  Long-term depression
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172156 (IGF1R)
   04014 Ras signaling pathway
    100172156 (IGF1R)
   04015 Rap1 signaling pathway
    100172156 (IGF1R)
   04066 HIF-1 signaling pathway
    100172156 (IGF1R)
   04068 FoxO signaling pathway
    100172156 (IGF1R)
   04151 PI3K-Akt signaling pathway
    100172156 (IGF1R)
   04152 AMPK signaling pathway
    100172156 (IGF1R)
   04150 mTOR signaling pathway
    100172156 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100172156 (IGF1R)
   04140 Autophagy - animal
    100172156 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100172156 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100172156 (IGF1R)
   04520 Adherens junction
    100172156 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    100172156 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100172156 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    100172156 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    100172156 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    100172156 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    100172156 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172156 (IGF1R)
   05202 Transcriptional misregulation in cancer
    100172156 (IGF1R)
   05205 Proteoglycans in cancer
    100172156 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100172156 (IGF1R)
   05214 Glioma
    100172156 (IGF1R)
   05218 Melanoma
    100172156 (IGF1R)
   05215 Prostate cancer
    100172156 (IGF1R)
   05224 Breast cancer
    100172156 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100172156 (IGF1R)
   01522 Endocrine resistance
    100172156 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100172156 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100172156 (IGF1R)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100172156 (IGF1R)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100172156 (IGF1R)
CD molecules [BR:pon04090]
 Proteins
  100172156 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Recep_L_domain fn3 Furin-like Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 100172156
NCBI-ProteinID: NP_001125259
Ensembl: ENSPPYG00000006808
UniProt: Q5RCL1
LinkDB
Position
15
AA seq 1064 aa
MQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLIN
IRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFYVL
DNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNG
ERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDA
CGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILY
IRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYC
SKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFE
NFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVD
NKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFVRTMPAEGADDIPGPVTWEPR
PENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTA
RIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRN
NSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVK
DEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMT
RGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMV
AEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLW
EIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRLAFLEII
SSIKDEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGH
KAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgcaggagtgcccctcgggcttcatccgcaacggcagccagagcatgtactgcatccca
tgtgaaggtccttgccccaaggtctgtgaggaagaaaagaaaacaaagaccattgattct
gttacttctgctcagatgctccaaggatgcaccatcttcaagggcaatttgctcattaac
atccgacgggggaataacattgcttcagaactggagaacttcatggggctcatcgaggtg
gtgacgggctacgtgaagatccgccattctcatgccttggtctccttgtccttcctaaaa
aaccttcgcctcatcttaggagaggagcagctagaagggaattactccttctacgtcctc
gacaaccagaacttgcagcaactatgggactgggaccaccgcaacctgaccatcaaagca
gggaaaatgtactttgctttcaatcccaaattatgtgtttctgaaatttaccgcatggag
gaagtgacggggactaaaggacgccaaagcaaaggggacataaacaccaggaacaacggg
gagagagcctcctgtgaaagtgatgtcctgcatttcacctccaccaccacgtcgaagaat
cgcatcatcataacctggcaccggtaccggccccctgactacagggatctcatcagcttc
accgtttactacaaggaagcaccctttaagaatgtcacggagtatgatgggcaggacgcc
tgcggctccaacagctggaacatggtggacgtggacctcccacccaacaaggacgtggag
cccggcatcttactgcatgggctgaagccctggactcagtacgccgtttacgtcaaggct
gtgaccctcaccatggtggagaacgaccatatccgtggagccaagagtgagatcttgtac
attcgcaccaatgcttcagttccttccattcccttggacgttctttcagcatcgaactcc
tcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaacctgagttac
tacattgtgcgctggcagcggcagcctcaggacggctacctttaccggcacaattactgc
tccaaagacaaaatccccatcaggaagtatgccgacggcaccatcgacattgaggaagtc
acagagaaccccaagactgaggtgtgtggtggtgagaaagggccttgctgcgcctgcccc
aaaactgaagccgagaagcaggctgagaaggaggaggctgagtaccgcaaagtctttgag
aatttcctgcacaactccatcttcgtgcccagacctgaaaggaagcggagagatgtcatg
caagtggccaacaccaccatgtccagccgaagcaggaacaccacggccgcagacacgtac
aacatcaccgacccagaagagctggagacagagtaccctttctttgagagcagagtggat
aacaaggagagaactgtcatttctaaccttcggcctttcacattgtaccgcatcgatatc
cacagctgcaatcatgaggctgagaagctgggctgcagcgcctccaacttcgtctttgta
aggactatgcccgcagaaggagcagatgacattcctgggccagtgacctgggagccaagg
cctgaaaactccatctttttaaagtggccagaacctgagaatcccaatggattgattcta
atgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtgtccagacag
gaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaactacacagcc
cggattcaggccacatctctctctgggaatgggtcgtggacagatcctgtgttcttctat
gtccaggccaaaacaggatatgaaaacttcatccatctgatcatcgctctgcccgtcgct
gtcctgttgattgtgggagggttggtgattatgctgtacgtcttccatagaaagagaaat
aacagcaggctggggaatggagtgctgtatgcctctgtgaacccggagtacttcagcgct
gcggatgtgtacgttcctgatgagtgggaggtggctcgggagaagatcaccatgagccgg
gaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggtgtggtgaaa
gatgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcaagcatgcgtgaa
aggatcgagtttctcaacgaagcttctgtgatgaaggagttcaattgtcaccatgtggtg
cgattgctgggtgtggtgtcccaaggccagccaacactggtcatcatggaactgatgaca
cggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaataatccagtc
ctagcacctccaagcctaagcaagatgattcagatggccggagagattgcagacggcatg
gcatacctcaacgccaacaagttcgtccacagagaccttgctgcccggaattgcatggta
gccgaagatttcacagtcaaaatcggagattttggtatgacgcgagatatctatgagaca
gactattaccggaaaggagggaaagggctgctgcccgtgcgctggatgtctcccgagtcc
ctcaaggatggagtcttcaccacttactcggacgtctggtccttcggggtcgtcctctgg
gagattgccacactggccgagcagccctaccagggcttgtccaacgagcaagtccttcgc
ttcgtcatggagggcggccttctggacaagccagacaactgtcctgacatgctgtttgaa
ctgatgcgcatgtgctggcagtataaccccaagatgaggcttgccttcctggagatcatc
agcagcatcaaagacgagatggagcctggcttccgggaggtctccttctactacagcgag
gagaacaagctgcccgagccggaggaactggacctcgagccagagaacatggagagcgtc
cccctggacccctcggcctcctcgtcctccctgccactgcccgacagacactcaggacac
aaggccgagaacggccccggccctggagtactggtcctccgcgccagcttcgacgagaga
cagccttacgcacacatgaacgggggccgcaagaacgagcgggccttgccactgccccag
tcttcgacctgctga

DBGET integrated database retrieval system