KEGG   Pongo abelii (Sumatran orangutan): 100172192
Entry
100172192         CDS       T01416                                 

Gene name
CYP1B1
Definition
(RefSeq) cytochrome P450 1B1
  KO
K07410  cytochrome P450 family 1 subfamily B1 [EC:1.14.14.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00140  Steroid hormone biosynthesis
pon00380  Tryptophan metabolism
pon00980  Metabolism of xenobiotics by cytochrome P450
pon04913  Ovarian steroidogenesis
pon05204  Chemical carcinogenesis
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100172192 (CYP1B1)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    100172192 (CYP1B1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100172192 (CYP1B1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100172192 (CYP1B1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100172192 (CYP1B1)
   05204 Chemical carcinogenesis
    100172192 (CYP1B1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pon00199]
    100172192 (CYP1B1)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100172192 (CYP1B1)
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP1 family
   100172192 (CYP1B1)
SSDB
Motif
Pfam: p450 GIT_CC
Other DBs
NCBI-GeneID: 100172192
NCBI-ProteinID: NP_001125294
Ensembl: ENSPPYG00000012485
UniProt: Q5RCF5
LinkDB
Position
2A
AA seq 172 aa
MGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVVFVNQWSVNHDP
AKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQC
NFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQKLQAEETCQ
NT seq 519 nt   +upstreamnt  +downstreamnt
atgggtgaccagcccaacctgccctatgtcctggccttcctttatgaagccatgcgcttc
tccagctttgtgcctgtcactattcctcatgccaccactgccaacacctctgtcttgggc
taccacattcccaaggacactgtggtttttgtcaaccagtggtctgtgaatcatgaccca
gcgaagtggcctaatccggagaactttgatccagctcgattcttggacaaggacggcctc
atcaacaaggacctgaccagcagagtgatgattttttcagtgggcaaaaggcggtgcatt
ggcgaagaactttctaagatgcagctttttctcttcatctccatcctggctcaccagtgc
aatttcagggccaacccaaatgagcctgcgaaaatgaatttcagttatggtctgaccatt
aaacccaagtcatttaaagtcaacgtcactctcagagagtccatggagctccttgatagt
gctgtccaaaagttacaagccgaggaaacttgccaataa

DBGET integrated database retrieval system