Pongo abelii (Sumatran orangutan): 100172422 Help Entry 100172422         CDS       T01416                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04014   Ras signaling pathway pon04137   Mitophagy - animal pon04144   Endocytosis pon04145   Phagosome pon04148   Efferocytosis pon04962   Vasopressin-regulated water reabsorption pon05132   Salmonella infection pon05146   Amoebiasis pon05152   Tuberculosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100172422 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100172422 (RAB5B)    04145 Phagosome     100172422 (RAB5B)    04137 Mitophagy - animal     100172422 (RAB5B)    04148 Efferocytosis     100172422 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100172422 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100172422 (RAB5B)    05152 Tuberculosis     100172422 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     100172422 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100172422 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pon04147]     100172422 (RAB5B)    04031 GTP-binding proteins [BR:pon04031]     100172422 (RAB5B) Membrane trafficking [BR:pon04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100172422 (RAB5B)  Endosome - Lysosome transport     100172422 (RAB5B) Exosome [BR:pon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100172422 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    100172422 (RAB5B)   Exosomal proteins of colorectal cancer cells    100172422 (RAB5B)   Exosomal proteins of melanoma cells    100172422 (RAB5B) GTP-binding proteins [BR:pon04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100172422 (RAB5B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 SDR-like Motif Other DBs NCBI-GeneID:  100172422 NCBI-ProteinID:  NP_001125512 UniProt:  Q5RBG1 A0A2J8UHV6 LinkDB All DBs Position 12:53735114..53756632 Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagctaggcccaatgggcaaccccaggccagcaaaatttgccag ttcaaattggtcctgctgggagaatctgcagtgggaaagtcaagcctggtattacgtttt gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttcctcacccag tccgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggag cgatatcacagcttagcccccatgtactacaggggtgcccaagctgcaatcgtggtttac gacattactaatcaggaaacctttgcccgagcaaagacatgggtgaaagaactacagcga caggccagtcctagcatcgttattgcgctggcagggaacaaagctgacctggccaacaag cgtatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgttcatg gagacttcagccaagacggctatgaacgtgaatgatctctttctggcaatagctaagaag ttgccaaagagtgaaccccagaatctgggaggtgcagcaggccgaagccggggtgtggat ctccatgaacagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system