KEGG   Pongo abelii (Sumatran orangutan): 100172422
Entry
100172422         CDS       T01416                                 

Gene name
RAB5B
Definition
(RefSeq) ras-related protein Rab-5B
  KO
K07888  Ras-related protein Rab-5B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04962  Vasopressin-regulated water reabsorption
pon05132  Salmonella infection
pon05146  Amoebiasis
pon05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100172422 (RAB5B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100172422 (RAB5B)
   04145 Phagosome
    100172422 (RAB5B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100172422 (RAB5B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100172422 (RAB5B)
   05152 Tuberculosis
    100172422 (RAB5B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100172422 (RAB5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100172422 (RAB5B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100172422 (RAB5B)
   04031 GTP-binding proteins [BR:pon04031]
    100172422 (RAB5B)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    100172422 (RAB5B)
 Endosome - Lysosome transport
    100172422 (RAB5B)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100172422 (RAB5B)
  Exosomal proteins of other body fluids (saliva and urine)
   100172422 (RAB5B)
  Exosomal proteins of colorectal cancer cells
   100172422 (RAB5B)
  Exosomal proteins of melanoma cells
   100172422 (RAB5B)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100172422 (RAB5B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 100172422
NCBI-ProteinID: NP_001125512
UniProt: Q5RBG1 A0A2J8UHV6
LinkDB
Position
12
AA seq 215 aa
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgactagcagaagcacagctaggcccaatgggcaaccccaggccagcaaaatttgccag
ttcaaattggtcctgctgggagaatctgcagtgggaaagtcaagcctggtattacgtttt
gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttcctcacccag
tccgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggag
cgatatcacagcttagcccccatgtactacaggggtgcccaagctgcaatcgtggtttac
gacattactaatcaggaaacctttgcccgagcaaagacatgggtgaaagaactacagcga
caggccagtcctagcatcgttattgcgctggcagggaacaaagctgacctggccaacaag
cgtatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgttcatg
gagacttcagccaagacggctatgaacgtgaatgatctctttctggcaatagctaagaag
ttgccaaagagtgaaccccagaatctgggaggtgcagcaggccgaagccggggtgtggat
ctccatgaacagtcccagcagaacaagagccagtgttgtagcaactga

KEGG   Pongo abelii (Sumatran orangutan): 100174605
Entry
100174605         CDS       T01416                                 

Gene name
RAB5C
Definition
(RefSeq) ras-related protein Rab-5C
  KO
K07889  Ras-related protein Rab-5C
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04962  Vasopressin-regulated water reabsorption
pon05132  Salmonella infection
pon05146  Amoebiasis
pon05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100174605 (RAB5C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100174605 (RAB5C)
   04145 Phagosome
    100174605 (RAB5C)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100174605 (RAB5C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100174605 (RAB5C)
   05152 Tuberculosis
    100174605 (RAB5C)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100174605 (RAB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100174605 (RAB5C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100174605 (RAB5C)
   04031 GTP-binding proteins [BR:pon04031]
    100174605 (RAB5C)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    100174605 (RAB5C)
 Endosome - Lysosome transport
    100174605 (RAB5C)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100174605 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   100174605 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   100174605 (RAB5C)
  Exosomal proteins of bladder cancer cells
   100174605 (RAB5C)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100174605 (RAB5C)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 100174605
NCBI-ProteinID: NP_001127529
Ensembl: ENSPPYG00000008398
UniProt: Q5R7L7
LinkDB
Position
17
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcggggaggcgcagcacgacccaatggaccagctgctgggaacaagatctgt
caatttaagctggttctgctgggggagtctgcggtaggcaaatccagcctcgtcctccgc
tttgtcaagggacagtttcacgagtaccaggagagcacaattggagcggccttcctcaca
cagactgtctgcctggatgacacaacagtcaagtttgagatctgggacacagctggacag
gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc
tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag
aggcaggccagccccaacatcgtcattgcactcgcgggtaacaaggcagacctggccagc
aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc
atggagacatcagcaaagactgcaatgaacgtgaacgaaatcttcatggcaatagctaag
aagcttcccaagaacgagccccagaatgcaactggtgctccaggccgaaaccgaggtgtg
gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

KEGG   Pongo abelii (Sumatran orangutan): 100446432
Entry
100446432         CDS       T01416                                 

Gene name
RAB5A
Definition
(RefSeq) ras-related protein Rab-5A
  KO
K07887  Ras-related protein Rab-5A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04144  Endocytosis
pon04145  Phagosome
pon04962  Vasopressin-regulated water reabsorption
pon05014  Amyotrophic lateral sclerosis
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05146  Amoebiasis
pon05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100446432 (RAB5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100446432 (RAB5A)
   04145 Phagosome
    100446432 (RAB5A)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100446432 (RAB5A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100446432 (RAB5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100446432 (RAB5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100446432 (RAB5A)
   05152 Tuberculosis
    100446432 (RAB5A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100446432 (RAB5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100446432 (RAB5A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100446432 (RAB5A)
   04031 GTP-binding proteins [BR:pon04031]
    100446432 (RAB5A)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    100446432 (RAB5A)
 Endosome - Lysosome transport
    100446432 (RAB5A)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100446432 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   100446432 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   100446432 (RAB5A)
  Exosomal proteins of bladder cancer cells
   100446432 (RAB5A)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100446432 (RAB5A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Other DBs
NCBI-GeneID: 100446432
NCBI-ProteinID: XP_002814060
Ensembl: ENSPPYG00000014074
UniProt: H2PBC6 A0A6D2WJA9
LinkDB
Position
3
AA seq 215 aa
MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atggctagtcgaggcgcaacaagacccaacgggccaaatactggaaataaaatatgccag
ttcaaactagtacttctgggagagtccgctgttggcaaatcaagcctagtgcttcgtttt
gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa
actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa
cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat
gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg
caagcaagtcctaacattgtaatagctttatcaggaaacaaggccgacctagcaaataaa
agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg
gagacatccgctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa
ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggagtggac
cttaccgaacccacacaaccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system