KEGG   Pongo abelii (Sumatran orangutan): 100172445
Entry
100172445         CDS       T01416                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin alpha-1 chain
  KO
K10373  tropomyosin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04260  Cardiac muscle contraction
pon04261  Adrenergic signaling in cardiomyocytes
pon05206  MicroRNAs in cancer
pon05410  Hypertrophic cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100172445 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    100172445 (TPM1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100172445 (TPM1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100172445 (TPM1)
   05414 Dilated cardiomyopathy
    100172445 (TPM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100172445 (TPM1)
   04147 Exosome [BR:pon04147]
    100172445 (TPM1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100172445 (TPM1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100172445 (TPM1)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd CENP-F_leu_zip DUF3450 Crescentin DUF745 DUF1664 Laminin_I
Other DBs
NCBI-GeneID: 100172445
NCBI-ProteinID: NP_001125533
Ensembl: ENSPPYG00000006534
UniProt: Q5RBC9
LinkDB
Position
15
AA seq 284 aa
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDIAAKEKLLRVSEDERDRV
LEELHKAEDSLLAAEEAAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLELNNM
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaacgcgttggat
cgagctgagcaggcggaggcagacaagaaggcggcggaagacaggagcaagcagctcgag
gaggacatcgcggccaaggagaagttgctgcgggtgtcggaggacgagcgggaccgggtg
ctggaggagctgcacaaggcggaggacagcctcctggccgccgaagaggccgccgccaag
gctgaagccgatgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgtctggcaacagctttgcagaagctggaggaagctgagaaggcagca
gatgagagtgagagaggcatgaaagtcattgagagtcgagcccaaaaagatgaagaaaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aaatatgaagaggtggcccgtaagctggtcatcattgagagcgacctggaacgtgcagag
gagcgggctgagctctcagaaggcaaatgtgccgagcttgaagaagaattgaaaactgtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacaaa
tatgaggaagagatcaaggtcctttccgacaagctgaaggaggctgagactcgagctgag
tttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaagagaaagtg
gctcatgccaaagaagaaaaccttagtatgcatcagatgctggatcagactttactggag
ttaaacaacatgtga

DBGET integrated database retrieval system