KEGG   Pongo abelii (Sumatran orangutan): 100172457
Entry
100172457         CDS       T01416                                 

Gene name
NR4A1
Definition
(RefSeq) nuclear receptor subfamily 4 group A member 1
  KO
K04465  nuclear receptor subfamily 4 group A member 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04927  Cortisol synthesis and secretion
pon04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100172457 (NR4A1)
   04151 PI3K-Akt signaling pathway
    100172457 (NR4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100172457 (NR4A1)
   04927 Cortisol synthesis and secretion
    100172457 (NR4A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100172457 (NR4A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100172457 (NR4A1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pon03310]
    100172457 (NR4A1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys4 nerve growth factor IB-like
    100172457 (NR4A1)
Nuclear receptors [BR:pon03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   100172457 (NR4A1)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100172457
NCBI-ProteinID: NP_001125545
Ensembl: ENSPPYG00000004537
UniProt: Q5RBB0
LinkDB
Position
12
AA seq 598 aa
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGY
TGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPV
DEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKA
SGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLASTSPHL
EGSGILDAPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLRGRRGRLPSKPKQPPDAS
PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLEVIRKW
AEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFG
DWIDSILAFSRSLHSLVVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVA
AVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgccctgtatccaagcccaatatgggacaccagcaccaagtccaggaccccgtgaccac
ctggcaagcgaccccttgacccctgagttcatcaagcccaccatggacctggccagcccc
gaggcggcccccgctgcccccactgccctgcccagcttcagcaccttcatggacggctac
acaggagagtttgacaccttcctctatcagctgccgggaacagtccagccatgctcctca
gcctcctcctcagcctcctccacatcctcgtcctcagccacctcccctgcctctgcctcc
ttcaagtttgaggacttccaggtgtacggctgctaccccggccccctgagcggcccggtg
gatgaggccctgtcctccagtggctctgactactatggcagcccctgctcggccccatca
ccctccacgcccagcttccagccgccccagctctctccctgggatggctcattcggccac
ttctcgcctagccagacttacgaaggcctgcgggcatggacagagcagctgcccaaagcc
tctgggcccccacagcctccagccttcttttccttcagtcctcccaccggtcccagcccc
agcctggctcagagccccctgaagttgttcccctcacaggccacccaccagctgggggag
ggagagagctattccatgcctacggccttcccaggtttggcatccacttctccacacctt
gagggctcggggatactggatgcacctgtgacctcaaccaaggcccggagcggggcccca
ggtggaagtgaaggccgctgtgctgtgtgtggggacaacgcgtcgtgccagcattatggc
gtccgcacctgcgagggctgcaagggcttcttcaagcgcacagtacagaaaaacgccaag
tacatctgcctggctaacaaggactgccctgtggacaagaggcggcgaaaccgctgccag
ttctgccgcttccagaagtgcctggcggtgggcatggtgaaggaagttgtccgaacagac
agcctgagggggcggcggggccggctaccttcaaaacccaagcagcccccagatgcctcc
cctgccaatctcctcacttccctggtccgtgcacacctggactcagggcccagcactgcc
aaactggactactccaagttccaggagctagtgctgccccgctttgggaaggaagatgct
ggggatgtacagcagttctacgacctgctctccggttctctggaggtcatccgcaagtgg
gcggagaagatccctggctttgctgagctgtcaccagctgaccaggacctgttgctggag
tcggccttcctggagctcttcatcctccgcctggcatacaggtctaagccaggcgagggc
aagctcatcttctgctcaggcctggtgctacaccggctgcagtgtgcccgtggcttcggc
gactggattgacagcatcctggccttctcaaggtccctgcacagcttggttgtcgatgtc
cctgccttcgcctgcctctctgcccttgtcctcatcaccgaccggcatgggctgcaggag
ccgcggcgggtggaggagctgcagaaccgcatcgccagctgcctgaaggagcacgtggca
gctgtggcgggcgagccccagccagccagctgcctgtcacgtctgttgggcaaactgccc
gagctgcggaccctgtgcacccagggcctgcagcgcatcttctacctcaagctggaggac
ttggtgccccctccacccatcattgacaagatcttcatggacacactgcccttctga

DBGET integrated database retrieval system