KEGG   Pongo abelii (Sumatran orangutan): 100172663
Entry
100172663         CDS       T01416                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04213  Longevity regulating pathway - multiple species
pon04330  Notch signaling pathway
pon04613  Neutrophil extracellular trap formation
pon04919  Thyroid hormone signaling pathway
pon05016  Huntington disease
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05165  Human papillomavirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100172663 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100172663 (HDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100172663 (HDAC1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100172663 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100172663 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172663 (HDAC1)
   05202 Transcriptional misregulation in cancer
    100172663 (HDAC1)
   05206 MicroRNAs in cancer
    100172663 (HDAC1)
   05203 Viral carcinogenesis
    100172663 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100172663 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100172663 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100172663 (HDAC1)
   05034 Alcoholism
    100172663 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100172663 (HDAC1)
   05165 Human papillomavirus infection
    100172663 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100172663 (HDAC1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100172663 (HDAC1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100172663 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     100172663 (HDAC1)
    BRAF-HDAC complex
     100172663 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100172663 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    100172663 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 100172663
NCBI-ProteinID: NP_001125738
Ensembl: ENSPPYG00000001595
UniProt: Q5RAG0
LinkDB
Position
1
AA seq 482 aa
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagacgcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagcgatgactacattaaattcttgcgctccatccgt
ccagataacatgtcggagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtattcgatggcctgtttgagttctgtcagttgtctactggtggttctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtacattgacattgatattcaccatggt
gacggcgtggaagaggccttctacaccacggaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctacgggatatcggggctggcaaaggcaag
tattatgctgttaactacccgctccgagacgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgcggtggtcttacag
tgtggctcagactccctatctggggatcggttaggttgcttcaatctaactatcaaagga
cacgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggaggc
ggtggttacaccattcgtaacgttgcccggtgctggacatatgagacagctgtggccctg
gatacggagatccctaatgagcttccatacaatgactactttgaatactttggaccagat
ttcaagctccacatcagtccttccaatatgactaaccagaacacgaatgagtacctggag
aagatcaaacagcgactgtttgagaaccttagaatgctgccgcacgcacctggggtccaa
atgcaggcgattcctgaggacgccatccctgaggagagtggcgatgaggacgaagacgac
cctgacaagcgcatctcgatctgctcctctgacaaacgaattgcctgtgaggaagagttc
tccgattctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagacccagaggagaagaaagaagtcacc
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

KEGG   Pongo abelii (Sumatran orangutan): 100294534
Entry
100294534         CDS       T01416                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04213  Longevity regulating pathway - multiple species
pon04330  Notch signaling pathway
pon04613  Neutrophil extracellular trap formation
pon04919  Thyroid hormone signaling pathway
pon05016  Huntington disease
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05165  Human papillomavirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100294534 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100294534 (HDAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100294534 (HDAC2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100294534 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100294534 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100294534 (HDAC2)
   05202 Transcriptional misregulation in cancer
    100294534 (HDAC2)
   05206 MicroRNAs in cancer
    100294534 (HDAC2)
   05203 Viral carcinogenesis
    100294534 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100294534 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100294534 (HDAC2)
  09165 Substance dependence
   05031 Amphetamine addiction
    100294534 (HDAC2)
   05034 Alcoholism
    100294534 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100294534 (HDAC2)
   05165 Human papillomavirus infection
    100294534 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100294534 (HDAC2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100294534 (HDAC2)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100294534 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     100294534 (HDAC2)
    BRAF-HDAC complex
     100294534 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100294534 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    100294534 (HDAC2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 100294534
NCBI-ProteinID: NP_001153253
UniProt: Q5R6R9
LinkDB
Position
6
AA seq 219 aa
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRVRLNSV
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaaaaaaaaagtctgctactactacgacggtgatatt
ggaaattattattatggacagggtcatcccatgaagcctcatagaatccgcatgacccat
aacttgctgttaaattatggcttatacagaaaaatggaaatatataggccccataaagcc
actgccgaagaaatgacaaaatatcacagtgatgagtatatcaaatttctacggtcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaagat
tgtccagtgtttgatggactctttgagttttgtcagctctcaactggcggttcagttgct
ggagctgtgaagttaaaccgacaacagactgatatggctgttaactgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttacgttaatgatattgtgcttgcc
atcctcgaattactaaagtatcatcagagagtcttatatattgatatagatattcatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgacggtatcattccat
aaatatggggaatactttcctggcacaggagacttgagggtaagactaaattctgtctga

DBGET integrated database retrieval system