KEGG   Pongo abelii (Sumatran orangutan): 100172719
Entry
100172719         CDS       T01416                                 

Gene name
GFAP
Definition
(RefSeq) glial fibrillary acidic protein
  KO
K05640  glial fibrillary acidic protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100172719 (GFAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100172719 (GFAP)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100172719 (GFAP)
Membrane trafficking [BR:pon04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    100172719 (GFAP)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     100172719 (GFAP)
SSDB
Motif
Pfam: Filament Filament_head Spc7 DUF1664 Topoisom_I_N
Other DBs
NCBI-GeneID: 100172719
NCBI-ProteinID: NP_001125791
Ensembl: ENSPPYG00000008318
UniProt: Q5RA72 A0A2J8UYQ8
LinkDB
Position
17
AA seq 432 aa
MERRRITSAARRSYISSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA
GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL
RELRLRLDQLTANSARLEVERDNLAQDLGTVRQKLQDETNLRLEAENNLAAYRQEADEAT
LARLDLERKTESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDMAKPDLTAALKEIRT
QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR
GTNESLERQMREQEERHAREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD
IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggagaggagacgcatcacctccgctgctcgccgttcctacatctcctcgggggagatg
atggtggggggcctggctcctggccgccgtctgggtcctggcacccgcctctccctggct
cgaatgccccctccactcccgacccgggtggacttctccctggccggggcactcaatgct
ggcttcaaggagacccgggccagtgagcgggcagagatgatggagctcaatgaccgcttt
gccagctacatcgagaaggttcgcttcctggaacagcaaaacaaggcgctggctgctgag
ctgaaccagctgcgggccaaggagcccaccaagctggctgacgtctaccaggctgagctg
cgagagttgcggctgcggctcgatcaactcaccgccaacagcgcccggctggaggtcgag
agggacaatctggcacaggacctgggcaccgtgaggcagaagctccaggatgaaaccaac
ctgaggctggaggccgagaacaacctggctgcctacagacaggaagcagatgaagccacc
ctggcccgcctggatctggagaggaagactgagtcactggaagaggagatccggttcttg
aggaagatccacgaggaggaggttcgggaactccaggagcagctggcccgacagcaggtc
catgtggagcttgacatggccaagccagacctcaccgcagccctgaaagagatccgcacg
cagtatgaggcaatggcgtccagcaacatgcatgaggccgaggagtggtaccgctccaag
tttgcagacctgacagacgctgctgcccgcaacgcggagctgctccgccaggccaagcac
gaggccaacgactaccggcgccagttgcagtccttgacctgcgacctggagtctctgcgc
ggcacgaacgagtccctggagaggcagatgcgcgagcaggaggagcgccacgcgcgggag
gcggccagttatcaggaggcgctggcgcggctggaggaagagggtcagagcctcaaggac
gagatggcccgccacttacaggagtaccaggacctgctcaacgtcaagctggccctggac
atcgagatcgccacctacaggaagctgctggagggcgaggagaaccggatcaccattccc
gtgcagaccttctccaacctgcagattcgagaaaccagcctggacaccaagtctgtgtca
gaaggccacctcaagaggaacattgtggtgaagacagtggagatgcgggatggagaggtc
attaaggagtccaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system