KEGG   Pongo abelii (Sumatran orangutan): 100172740
Entry
100172740         CDS       T01416                                 

Gene name
CCL2
Definition
(RefSeq) C-C motif chemokine 2 precursor
  KO
K14624  C-C motif chemokine 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04062  Chemokine signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04668  TNF signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05135  Yersinia infection
pon05142  Chagas disease
pon05144  Malaria
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05168  Herpes simplex virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05323  Rheumatoid arthritis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100172740 (CCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100172740 (CCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100172740 (CCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100172740 (CCL2)
   04657 IL-17 signaling pathway
    100172740 (CCL2)
   04062 Chemokine signaling pathway
    100172740 (CCL2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100172740 (CCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100172740 (CCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100172740 (CCL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100172740 (CCL2)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100172740 (CCL2)
   05164 Influenza A
    100172740 (CCL2)
   05168 Herpes simplex virus 1 infection
    100172740 (CCL2)
   05163 Human cytomegalovirus infection
    100172740 (CCL2)
  09174 Infectious disease: parasitic
   05144 Malaria
    100172740 (CCL2)
   05142 Chagas disease
    100172740 (CCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100172740 (CCL2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100172740 (CCL2)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Chemokines
   100172740 (CCL2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Chemokines
   100172740 (CCL2)
SSDB
Motif
Pfam: IL8 GPR15L
Other DBs
NCBI-GeneID: 100172740
NCBI-ProteinID: NP_001125812
UniProt: Q5RA36
LinkDB
Position
17
AA seq 99 aa
MKVSAALLCLLLIAATFSPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTLKT
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaagtctctgcagcacttctgtgcctgctgctcatagcagccaccttcagcccccag
gggctcgctcagccagatgcaatcaatgccccagtcacctgctgctataacttcaccaat
aggaagatttcagtgcagaggctggcgagctatagaagaatcaccagcagcaagtgtccc
aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag
aagtgggttcaggattccatggaccacctggacaagcaaacccaaactctgaagacttga

DBGET integrated database retrieval system