KEGG   Pongo abelii (Sumatran orangutan): 100172994Help
Entry
100172994         CDS       T01416                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha precursor
  KO
K08774  transforming growth factor, alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04915  Estrogen signaling pathway
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05223  Non-small cell lung cancer
pon05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100172994 (TGFA)
   04010 MAPK signaling pathway
    100172994 (TGFA)
   04012 ErbB signaling pathway
    100172994 (TGFA)
   04151 PI3K-Akt signaling pathway
    100172994 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100172994 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100172994 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100172994 (TGFA)
   05212 Pancreatic cancer
    100172994 (TGFA)
   05225 Hepatocellular carcinoma
    100172994 (TGFA)
   05214 Glioma
    100172994 (TGFA)
   05211 Renal cell carcinoma
    100172994 (TGFA)
   05215 Prostate cancer
    100172994 (TGFA)
   05223 Non-small cell lung cancer
    100172994 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100172994 (TGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF EGF_2 TMEM154
Motif
Other DBs
NCBI-GeneID: 100172994
NCBI-ProteinID: NP_001126045
Ensembl: ENSPPYG00000012322
UniProt: Q5R8W2
LinkDB All DBs
Position
2A
AA seq 160 aa AA seqDB search
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSTLLKGRTACCHSETVV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgcgctgggtattgtgttggccgcgtgc
caggccttggagaacagcacgtccccgctgagcgcagacccgcccgtggccgcagcagtg
gtgtcccattttaatgactgcccagattcccacactcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgca
cgctgtgagcatgcggacctcttggccgtggtggccgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagcaccctcctgaagggaagaaccgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system