KEGG   Pongo abelii (Sumatran orangutan): 100173023
Entry
100173023         CDS       T01416                                 

Gene name
ACTR3
Definition
(RefSeq) actin-related protein 3
  KO
K18584  actin-related protein 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100173023 (ACTR3)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100173023 (ACTR3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173023 (ACTR3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100173023 (ACTR3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100173023 (ACTR3)
   05135 Yersinia infection
    100173023 (ACTR3)
   05100 Bacterial invasion of epithelial cells
    100173023 (ACTR3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100173023 (ACTR3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100173023 (ACTR3)
   04147 Exosome [BR:pon04147]
    100173023 (ACTR3)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100173023 (ACTR3)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100173023 (ACTR3)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100173023 (ACTR3)
  Exosomal proteins of other body fluids (saliva and urine)
   100173023 (ACTR3)
  Exosomal proteins of bladder cancer cells
   100173023 (ACTR3)
SSDB
Motif
Pfam: Actin MreB_Mbl ALP_N FtsA Robl_LC7
Other DBs
NCBI-GeneID: 100173023
NCBI-ProteinID: NP_001126071
Ensembl: ENSPPYG00000012798
UniProt: Q5R8R1 A0A2J8T239
LinkDB
Position
2B
AA seq 418 aa
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDF
FIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP
ENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVK
EFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKP
KPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcgggacggctgccggcctgtgtggtggactgtggcacggggtatacaaaactagga
tatgctggaaatacagaaccacagtttatcatcccttcctgtattgctattaaggagtca
gcaaaagtgggtgatcaagctcaaaggagggtgatgaaaggcgttgatgacctagacttc
ttcattggtgatgaagcaatagaaaaacctacatatgcaacaaagtggccaatccgccat
ggtatagttgaagattgggacttaatggaaaggtttatggagcaagtgatctttaaatat
ttaagggcagaacctgaagaccattattttcttttgactgaacctccattgaatactcca
gaaaacagggaatatactgctgaaataatgtttgagtccttcaatgttccaggcttgtac
attgctgtgcaggctgttcttgccttagctgcatcttggacctcaagacaagtaggagaa
cggacgttgactggtacggtaatagacagtggagatggtgtcactcatgtcattcctgtg
gctgaagggtatgtgattggcagctgtattaaacacattccaatcgcaggacgagatata
acatattttattcagcaactgctgagagaccgagaagtaggaatccctccagaacaatcc
ttggaaactgctaaggcagtaaaggagcgctatagttatgtctgcccagatttagtaaaa
gaatttaacaagtatgatacagatgggtcaaagtggataaaacagtatactggaatcaat
gctatctcaaagaaagaattttctatcgatgttggttatgagagatttttgggacctgaa
atcttttttcatccagagtttgctaatccagactttacacaacctatctcagaagttgta
gatgaagtaattcagaattgtcctattgatgtcagacgtcctctctacaagaatattgtc
ctctctggaggttcaaccatgttcagggactttggacgtcgcttgcaaagagatttgaaa
agaactgtagatgcccggctgaaattaagtgaggaattgagtggcggtagattgaagcca
aaacctattgatgtacaagtcattacacaccacatgcagcgatatgcagtttggtttgga
ggatcaatgctggcttccacgcctgagttctaccaagtatgccacaccaaaaaggattat
gaagaaattggacctagcatttgtcgtcacaatccagtgtttggagtcatgtcgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100173646
Entry
100173646         CDS       T01416                                 

Gene name
ARPC2
Definition
(RefSeq) actin-related protein 2/3 complex subunit 2
  KO
K05758  actin related protein 2/3 complex, subunit 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100173646 (ARPC2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100173646 (ARPC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173646 (ARPC2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100173646 (ARPC2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100173646 (ARPC2)
   05135 Yersinia infection
    100173646 (ARPC2)
   05100 Bacterial invasion of epithelial cells
    100173646 (ARPC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100173646 (ARPC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100173646 (ARPC2)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100173646 (ARPC2)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100173646 (ARPC2)
SSDB
Motif
Pfam: P34-Arc ARPC4
Other DBs
NCBI-GeneID: 100173646
NCBI-ProteinID: NP_001126648
Ensembl: ENSPPYG00000013164
UniProt: Q5R5Z5 A0A2J8TTY2
LinkDB
Position
2B
AA seq 300 aa
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSIS
LKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNC
FASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKV
FMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNT
INLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
NT seq 903 nt   +upstreamnt  +downstreamnt
atgatcctgctggaggtgaacaaccgcatcatcgaggagacgctcgcgctcaagttcgag
aacgcggccgccggaaacaaaccggaagcagtagaagtaacatttgcagatttcgatggg
gtcctctatcatatttcaaatcctaatggagacaaaacaaaagtgatggtcagtatttct
ttgaaattctacaaggaacttcaggcacatggtgctgatgagttattaaagagggtgtac
gggagtttcttggtaaatccagaatcaggatacaatgtctctttgctatatgaccttgaa
aatcttccggcatccaaggattccattgtgcatcaagctggaatgttgaagcgaaattgt
tttgcctctgtctttgaaaagtacttccaattccaagaagagggcaaggaaggagagaac
agagcagttatccattatagggatgatgagaccatgtatgttgagtctaaaaaggacaga
gtcacggtagtcttcagcacagtgtttaaggatgacgacgatgtggtcattggaaaggtg
ttcatgcaggagttcaaagaaggacgcagagccagccacacagccccacaggtcctcttt
agccacagggaacctcctctggagctgaaagacacggacgccgctgtgggtgacaacatt
ggctacattacctttgtgctgttccctcgtcacaccaatgccagtgctcgagacaacacc
atcaacctgatccacacgttccgggactacctgcactaccacatcaagtgctctaaggcc
tatattcacacacgtatgcgggcgaaaacgtctgacttcctcaaggtgctgaaccgcgca
cgcccagatgccgagaaaaaagaaatgaaaacaatcacggggaagacgttttcatcccgc
taa

KEGG   Pongo abelii (Sumatran orangutan): 100173958
Entry
100173958         CDS       T01416                                 

Gene name
ARPC5L
Definition
(RefSeq) actin-related protein 2/3 complex subunit 5-like protein
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100173958 (ARPC5L)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100173958 (ARPC5L)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173958 (ARPC5L)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100173958 (ARPC5L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100173958 (ARPC5L)
   05135 Yersinia infection
    100173958 (ARPC5L)
   05100 Bacterial invasion of epithelial cells
    100173958 (ARPC5L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100173958 (ARPC5L)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100173958 (ARPC5L)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100173958 (ARPC5L)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100173958 (ARPC5L)
SSDB
Motif
Pfam: P16-Arc Utp12
Other DBs
NCBI-GeneID: 100173958
NCBI-ProteinID: NP_001126940
Ensembl: ENSPPYG00000019604
UniProt: Q5R4M1 A0A2J8SFR1
LinkDB
Position
9
AA seq 153 aa
MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAA
LRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPT
ENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcccggaacacgctgtcctcgcgcttccgccgggtggacatcgacgaatttgacgag
aacaaatttgtggacgagcaggaggaggcggcggcggcggcggcggagccaggcccggac
ccgagcgaggtggacgggctcctgcggcaaggggacatgcttcgggcattccatgcagcc
ttgcggaactctcccgtcaacaccaagaatcaagctgtgaaggagcgagcccagggcgtg
gtgctgaaagtgctcacaaacttcaagagcagcgagattgagcaggctgtgcagtcactg
gacagaaacggtgttgacttgttaatgaagtacatttataaaggctttgagaagcccaca
gaaaatagcagcgcagtgttactccagtggcacgaaaaggccttagcagtaggaggacta
ggctccattataagagtcctcacagcaagaaagactgtttaa

KEGG   Pongo abelii (Sumatran orangutan): 100173969
Entry
100173969         CDS       T01416                                 

Gene name
ACTR2
Definition
(RefSeq) actin-related protein 2
  KO
K17260  actin-related protein 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100173969 (ACTR2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100173969 (ACTR2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173969 (ACTR2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100173969 (ACTR2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100173969 (ACTR2)
   05135 Yersinia infection
    100173969 (ACTR2)
   05100 Bacterial invasion of epithelial cells
    100173969 (ACTR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100173969 (ACTR2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100173969 (ACTR2)
   04147 Exosome [BR:pon04147]
    100173969 (ACTR2)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100173969 (ACTR2)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100173969 (ACTR2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100173969 (ACTR2)
  Exosomal proteins of other body fluids (saliva and urine)
   100173969 (ACTR2)
  Exosomal proteins of bladder cancer cells
   100173969 (ACTR2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100173969
NCBI-ProteinID: NP_001126951
Ensembl: ENSPPYG00000012359
UniProt: Q5R4K0
LinkDB
Position
2A
AA seq 394 aa
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE
ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR
EKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEDFSLPHLTR
RLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL
VESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAV
LADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggacagccagggcaggaaggtggtggtgtgcgacaacggcaccgggtttgtgaagtgt
ggatatgcaggctctaactttccagaacacatcttcccagctttggttggaagacctatt
atcagatcaaccaccaaagtgggaaacattgaaatcaaggatcttatggttggtgatgag
gcaagtgaattacgatcaatgttagaagttaactaccctatggaaaatggcatagtacga
aattgggatgacatgaaacacctgtgggactacacatttggaccagagaaacttaatata
gataccagaaattgtaaaatcttactcacagaacctcctatgaacccaaccaaaaacaga
gagaagattgtagaggtaatgtttgaaacttaccagttttctggtgtatatgtagccatc
caggccgttctgactttgtacgctcaaggtttgttgactggtgtagtggtagactctgga
gatggtgtcactcacatttgcccagtatatgaagacttttctctccctcatcttaccagg
agactggatattgctgggagggatataactagatatcttatcaagctacttctgttgcga
ggatacgccttcaaccactctgctgattttgaaacggttcgcatgattaaagaaaaactg
tgttacgtgggatataatattgagcaagagcagaaactggccttagaaaccacagtatta
gttgaatcttatacactcccagatggacgtatcatcaaagttgggggagagagatttgaa
gcaccagaagctttatttcagcctcacttgatcaatgttgaaggagttggtgttgctgaa
ttgctttttaacacaattcaggcggctgacattgataccagatctgaattctacaaacac
attgtgctttctggagggtctacgatgtatcctggcctgccatcacggttggaacgagaa
cttaaacagctttacttagaacgagttttgaagggtgatgtggaaaaactttctaaattt
aagatccgcattgaagacccaccccgcagaaagcacatggtattcctgggtggtgcagtt
ctagcggatatcatgaaagacaaagacaacttttggatgacccgacaagagtaccaagaa
aagggtgtccgtgtgctagagaaacttggtgtgactgttcgataa

KEGG   Pongo abelii (Sumatran orangutan): 100174767
Entry
100174767         CDS       T01416                                 

Gene name
ARPC5
Definition
(RefSeq) actin-related protein 2/3 complex subunit 5
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100174767 (ARPC5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100174767 (ARPC5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100174767 (ARPC5)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100174767 (ARPC5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100174767 (ARPC5)
   05135 Yersinia infection
    100174767 (ARPC5)
   05100 Bacterial invasion of epithelial cells
    100174767 (ARPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100174767 (ARPC5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100174767 (ARPC5)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100174767 (ARPC5)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100174767 (ARPC5)
SSDB
Motif
Pfam: P16-Arc UTP15_C Utp12
Other DBs
NCBI-GeneID: 100174767
NCBI-ProteinID: NP_001127685
Ensembl: ENSPPYG00000000425
UniProt: Q5R516 A0A2J8V871
LinkDB
Position
1
AA seq 151 aa
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALK
NPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDN
SSAMLLQWHEKALAAGGVGSIVRVLTARKTV
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtcgaagaacacagtgtcgtcggcccggttccggaaggtggacgtggatgaatatgac
gagaacaagttcgtggacgaagaagatgggggcgacggccaggccgggcccgatgagggc
gaggtggactcctgcctgcggcaaggaaacatgacagctgccctacaggcagctctaaag
aacccccctatcaacaccaagagtcaggcagtgaaggaccgggcaggcagcattgtcttg
aaggtgctcatctcttttaaagctaacgatatagaaaaggcagttcaatctctggacaag
aatggtgtggatctcctaatgaagtacatttataaaggatttgagagcccctctgacaat
agcagtgctatgttactgcaatggcatgaaaaggcacttgctgctggaggagtagggtcc
attgttcgtgtcttgactgcaagaaaaactgtgtag

KEGG   Pongo abelii (Sumatran orangutan): 100454564
Entry
100454564         CDS       T01416                                 

Gene name
ACTR3B
Definition
(RefSeq) LOW QUALITY PROTEIN: actin-related protein 3B
  KO
K18584  actin-related protein 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100454564 (ACTR3B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100454564 (ACTR3B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100454564 (ACTR3B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100454564 (ACTR3B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100454564 (ACTR3B)
   05135 Yersinia infection
    100454564 (ACTR3B)
   05100 Bacterial invasion of epithelial cells
    100454564 (ACTR3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100454564 (ACTR3B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100454564 (ACTR3B)
   04147 Exosome [BR:pon04147]
    100454564 (ACTR3B)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100454564 (ACTR3B)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100454564 (ACTR3B)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100454564 (ACTR3B)
  Exosomal proteins of other body fluids (saliva and urine)
   100454564 (ACTR3B)
  Exosomal proteins of bladder cancer cells
   100454564 (ACTR3B)
SSDB
Motif
Pfam: Actin MreB_Mbl KilA-N Robl_LC7 ALP_N
Other DBs
NCBI-GeneID: 100454564
NCBI-ProteinID: XP_002818749
Ensembl: ENSPPYG00000018206
UniProt: H2PP45
LinkDB
Position
7
AA seq 464 aa
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDF
FIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP
ENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVK
EFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVV
DEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKP
KPVEVQXWSRITCSATPCGSEAPCWPQLPSSFRSATPRRTTKSTGPASAATTPSSESCPS
VCLNASFDGVMLGNKCPSEPREGRRSVNSDVGVAAQQRACIARA
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcaggctccctgcctccctgcgtggtggactgtggcaccgggtataccaagcttggc
tacgcaggcaacactgagccccagttcattattccttcatgtattgccatcagagagtca
gcaaaggtagttgaccaagcccaaaggagagtgttgaggggagttgatgaccttgacttt
ttcataggagatgaagccatcgataaacctacgtatgctacaaagtggccgatacgacat
ggaatcattgaagactgggatcttatggaaaggttcatggagcaagtggtttttaaatat
cttcgagctgaacctgaggaccattattttttaatgacagaacctccactcaatacacca
gaaaacagagagtatcttgcagaaattatgtttgaatcatttaacgtaccaggactctac
attgcagttcaggcagtgctggccttggcggcatcttggacatctcgacaagtgggtgaa
cgtacgttaacggggatagtcattgacagcggagatggagtcacccatgttatcccagtg
gcagaaggttatgtaattggaagctgcatcaaacacatcccgattgcaggtagagatatt
acgtatttcattcaacagctgctaagggagagggaggtgggaatccctcctgagcagtca
ctggagaccgcaaaagccattaaggagaaatactgttacatttgccccgatatagtcaag
gaatttgccaagtatgatgtggatccccggaagtggatcaaacagtacacgggtatcaat
gcgatcaaccagaagaagtttgttatagacgttggttacgaaagattcctgggacctgaa
atattctttcacccggagtttgccaacccagactttatggagtccatctcagatgttgtt
gatgaagtaatacagaactgccccatcgatgtgcggcgtccgctgtataagaatgtcgta
ctctcgggaggctccaccatgttcagggattttggacgccgactacagagggatttgaag
agagtggtggacgctaggctgaggctcagcgaggaactcagcggtgggaggatcaagcca
aagcctgtggaggtccagnngtggtcacgcatcacatgcagcgctacgccgtgtggttcg
gaggctccatgctggcctcaactcccgagttctttcaggtctgccacaccaagaaggact
acgaagagtacgggcccagcatctgccgccacaaccccgtcttcggagtcatgtcctagt
gtctgcctgaacgcgtcgttcgatggtgtcatgttggggaacaagtgtccttcagaaccc
agagaaggccgccgttctgtaaatagcgacgtcggtgttgctgcccagcagcgtgcttgc
attgcccgtgcatga

KEGG   Pongo abelii (Sumatran orangutan): 100458060
Entry
100458060         CDS       T01416                                 

Gene name
ARPC1B
Definition
(RefSeq) actin-related protein 2/3 complex subunit 1B
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100458060 (ARPC1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100458060 (ARPC1B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100458060 (ARPC1B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100458060 (ARPC1B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100458060 (ARPC1B)
   05135 Yersinia infection
    100458060 (ARPC1B)
   05100 Bacterial invasion of epithelial cells
    100458060 (ARPC1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100458060 (ARPC1B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100458060 (ARPC1B)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100458060 (ARPC1B)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100458060 (ARPC1B)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A
Other DBs
NCBI-GeneID: 100458060
NCBI-ProteinID: XP_002817759
Ensembl: ENSPPYG00000017374
LinkDB
Position
7
AA seq 372 aa
MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDW
APESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVI
SICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERP
APTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVTTL
ASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARE
RFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVK
SLESALKDLKIK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcctaccacagcttcctggtggagcccatcagctgccacgcctggaacaaggaccgc
acccagattgccatctgccccaacaaccatgaggtgcacatctacgaaaagagcggtgcc
aaatggaccaaggtgcacgaactcaaggagcacaacgggcaggtgacaggcatcgactgg
gcccccgagagtaaccgtattgtgacctgcggcacagaccgcaacgcctacgtgtggaca
ctgaagggccgcacgtggaagcccacactggtcatcctgcggatcaaccgggccgcccgc
tgcgtgcgctgggcccccaacgagaacaagtttgctgtgggcagcggctctcgtgtgatc
tccatctgttatttcgagcaggagaatgactggtgggtttgcaagcacatcaagaagccc
atccgctccaccgtcctcagcctggactggcaccccaacaatgtgctgctggctgccggc
tcctgtgacttcaagtgccggatcttttcagcctacatcaaggaggtggaggagcggccg
gcacccaccccgtggggctccaagatgccctttggggagctgatgttcgaatccagcagt
agctgcggctgggtacatggcgtctgcttctcagccagcgggagccgcgtggcctgggtg
agccacgacagcaccgtgtgcctggctgatgccgacaagaagatggccgtcacgactctg
gcctctgaaacgctaccactgctggcgctgaccttcatcacagacaacagcctggtggca
gcgggccatgactgcttcccggtgctgttcacctatgatgccgccgcggggatgctgagc
ttcggcgggcggctggacgttcccaagcagagctcgcagcgtggcttgacggcccgcgag
cgcttccagaacctggacaagaaggcgagctccgagggtggcacggctgcgggcgcgggc
ctggactcgctgcacaagaacagcgtcagccagatctcggtgctcagcgggggcaaggcc
aagtgctcgcagttctgcaccactggcatggatggcggcatgagtatctgggatgtgaag
agcttggagtcagccttgaaggacctcaagatcaaatga

KEGG   Pongo abelii (Sumatran orangutan): 100460433
Entry
100460433         CDS       T01416                                 

Gene name
ARPC3
Definition
(RefSeq) actin-related protein 2/3 complex subunit 3
  KO
K05756  actin related protein 2/3 complex, subunit 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100460433 (ARPC3)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100460433 (ARPC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460433 (ARPC3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100460433 (ARPC3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100460433 (ARPC3)
   05135 Yersinia infection
    100460433 (ARPC3)
   05100 Bacterial invasion of epithelial cells
    100460433 (ARPC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100460433 (ARPC3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100460433 (ARPC3)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100460433 (ARPC3)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100460433 (ARPC3)
SSDB
Motif
Pfam: P21-Arc
Other DBs
NCBI-GeneID: 100460433
NCBI-ProteinID: XP_024113054
Ensembl: ENSPPYG00000004947
LinkDB
Position
12
AA seq 178 aa
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEI
KNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
ANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
NT seq 537 nt   +upstreamnt  +downstreamnt
atgccggcttaccactcttctctcatggatcctgacaccaaactcatcggaaacatggca
ctgttgcctatcagaagtcaattcaaaggacctgcccccagagagacaaaagatacagat
attgtggatgaagccatctattacttcaaggccaatgtcttcttcaaaaactatgaaatt
aagaatgaagctgataggaccttgatatatataactctctacatttctgaatgtctgaag
aaactccaaaagtgcaattccaaaagccaaggtgagaaagaaatgtatacactgggaatc
actaattttcccattcctggagagcctggttttccacttaacgcaatttatgccaaacct
gcaaacaaacaggaagatgaagtgatgagagcctatttacaacagctaaggcaagagact
ggactgagactttgtgagaaagttttcgaccctcagaatgataaacccagcaagtggtgg
acttgctttgtgaagagacagttcatgaacaagagtctttcaggacctggacagtga

KEGG   Pongo abelii (Sumatran orangutan): 100461245
Entry
100461245         CDS       T01416                                 

Gene name
ARPC1A
Definition
(RefSeq) actin-related protein 2/3 complex subunit 1A
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100461245 (ARPC1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100461245 (ARPC1A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100461245 (ARPC1A)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100461245 (ARPC1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100461245 (ARPC1A)
   05135 Yersinia infection
    100461245 (ARPC1A)
   05100 Bacterial invasion of epithelial cells
    100461245 (ARPC1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100461245 (ARPC1A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100461245 (ARPC1A)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100461245 (ARPC1A)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100461245 (ARPC1A)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 LytB_WW
Other DBs
NCBI-GeneID: 100461245
NCBI-ProteinID: XP_024105324
LinkDB
Position
7
AA seq 370 aa
MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDW
APKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLI
SVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKP
ASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQVS
TLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQSIQRNMSAM
ERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTL
ESSIQGLRIM
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtcactgcatcagtttttactagagccaatcacctgtcatgcctggaacagggatcgt
actcagattgccctcagtcccaataatcacgaagtgcacatctataagaagaacgggagc
cagtgggtgaaagctcatgaactcaaggagcacaacggacacatcacaggtattgactgg
gctcccaagagcgaccgcatcgtcacttgtggggcagaccgcaatgcctatgtctggagt
cagaaagatggtgtttggaagccaaccctggtgatcctgagaattaatcgtgcagctact
tttgtgaagtggtccccgctagagaacaaatttgctgtgggaagtggagcacgactcatt
tctgtttgttactttgagtctgaaaatgactggtgggtgagcaagcacattaaaaagccg
attcgctccacagtcctcagcttggattggcatcccaacaacgttttgctggcagcagga
tcatgtgacttcaaatgcagagtgttttctgcctacatcaaagaagtggatgaaaagcca
gccagcacgccctggggcagcaagatgccttttgggcagctgatgtcggagtttggtggc
agtggcactggtggctgggtccacggggtcagcttctctgccagtgggagccgcctggcc
tgggtcagccatgacagcaccgtgtctgttgctgatgcctcaaaaagtgtgcaggtctca
actctgaagacggagttcctgccgctcctgagtgtgtcatttgtctcagagaacagcgtc
gtggctgctggccatgactgctgcccaatgctctttaactatgatgaccgcggctgcctg
accttcgtctccaagttagacatcccaaaacagagcatccagcgcaacatgtctgccatg
gaacgcttccgcaacatggacaagagagccacgactgaggaccgcaacacggccttggag
acgctgcaccagaatagcatcactcaagtctctatttatgaggtggacaagcaagattgt
cgcaaattttgcactactggcatcgatggagccatgacaatttgggatttcaagaccctc
gagtcttccatccagggcctccggataatgtga

KEGG   Pongo abelii (Sumatran orangutan): 100936009
Entry
100936009         CDS       T01416                                 

Gene name
ARPC4
Definition
(RefSeq) actin-related protein 2/3 complex subunit 4 isoform X1
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100936009 (ARPC4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100936009 (ARPC4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100936009 (ARPC4)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100936009 (ARPC4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100936009 (ARPC4)
   05135 Yersinia infection
    100936009 (ARPC4)
   05100 Bacterial invasion of epithelial cells
    100936009 (ARPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100936009 (ARPC4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100936009 (ARPC4)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    100936009 (ARPC4)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     100936009 (ARPC4)
SSDB
Motif
Pfam: ARPC4 Sm_like DUF5747
Other DBs
NCBI-GeneID: 100936009
NCBI-ProteinID: XP_024100545
LinkDB
Position
3
AA seq 223 aa
MVPSGSPGGDRSCASRERAGIAGLATSVLPLSGPASARDGERAGTPARDPRLFSLRTATL
RPYLSAVRATLQAALCLENFSSQVVERHNKPEVEVRSSKELLLQPVTISRNEKEKVLIEG
SINSVRVSIAVKQADEIEKILCHKFMRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQ
MYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
NT seq 672 nt   +upstreamnt  +downstreamnt
atggtaccgtccggaagtccgggcggagaccgtagctgcgcttctcgcgaaagggcaggc
atcgcggggctggccacttccgtacttccgctttccggcccagccagcgcccgcgatggt
gagagagccgggaccccggccagggacccccggctgttcagcctcaggactgccactctc
cgcccctacctgagtgccgtgcgggccacattgcaggctgccctctgcctggagaacttc
tcctcccaggttgtggaacgacacaacaagccggaagtggaagtcaggagtagcaaagag
ctcctgttacaacctgtgaccatcagcaggaatgagaaggaaaaggttctgattgagggc
tccatcaactctgtccgggtcagcattgctgtgaaacaggctgatgagatcgagaagatt
ttatgccacaagttcatgcgcttcatgatgatgcgagcagaaaacttctttatccttcga
aggaagcctgtggaggggtatgatatcagctttctgatcaccaacttccacacagagcag
atgtacaaacacaagttggtggactttgtgatccacttcatggaggagattgacaaggag
atcagtgagatgaagctgtcagtcaatgcccgtgcccgcattgtggctgaagagttcctt
aagaatttttaa

DBGET integrated database retrieval system