KEGG   Pongo abelii (Sumatran orangutan): 100173124
Entry
100173124         CDS       T01416                                 

Gene name
F3
Definition
(RefSeq) tissue factor precursor
  KO
K03901  coagulation factor III (tissue factor)
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04610  Complement and coagulation cascades
pon04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100173124 (F3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100173124 (F3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100173124 (F3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
    100173124 (F3)
CD molecules [BR:pon04090]
 Proteins
  100173124 (F3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pon00537]
 Others
  100173124 (F3)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100173124
NCBI-ProteinID: NP_001126163
Ensembl: ENSPPYG00000001139
UniProt: Q5R8A6 A0A6D2WUD5
LinkDB
Position
1
AA seq 295 aa
METPAWPRVPRPETAVAWTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
PLNQVYTVQISTKTGDWKSKCFYTADTECDLTDEIVKDVKQTYLARVFSYPAGNVGSTGS
AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVQDERTLVRRNNTFLSLRDVFG
KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTANRKSTDSPVE
CMGHKKGEFREIFYIIGAVVFAVIILVIILAISLHKCRKAGVGQSWKENSPLNVA
NT seq 888 nt   +upstreamnt  +downstreamnt
atggagacccctgcctggccccgcgtcccgcgccccgagaccgccgtcgcttggacgctc
ctgctcggctgggtcttcgcccaggtggccggcgcttcaggcactacaaatactgtggca
gcatataatttaacttggaaatcaactaatttcaagacaattttggagtgggaacccaaa
cccctcaatcaagtctacactgttcaaataagcactaagacaggagattggaaaagcaaa
tgcttttacacagcagacacagagtgtgacctcactgatgagattgtgaaggatgtgaag
cagacgtacttggcacgggtcttctcctacccggcagggaatgtggggagcaccggttct
gctggggagcctctgtatgagaactccccagagttcacaccttacctggagacaaacctc
ggacagccaacaattcagagttttgaacaagtgggaacaaaagtgaatgtgaccgtacaa
gatgaacggactttagtcagaaggaacaacactttcctaagcctccgggatgtttttggc
aaggacttaatttatacactttattattggaaatcttcaagttcgggaaagaaaacagcc
aaaacaaacactaatgagtttttgattgatgtggataaaggagaaaactactgtttcagt
gttcaagcagtgattccctcccgaacagctaaccggaagagtacagacagccccgtggag
tgtatgggccacaagaaaggggaattcagagaaatattctacatcattggagctgtggta
tttgcggtcatcatccttgtcatcatcctggctatatctctacacaagtgtagaaaggca
ggagtggggcagagctggaaggagaactccccgctgaatgtcgcataa

DBGET integrated database retrieval system