KEGG   Pongo abelii (Sumatran orangutan): 100173125
Entry
100173125         CDS       T01416                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon00590  Arachidonic acid metabolism
pon00591  Linoleic acid metabolism
pon00592  alpha-Linolenic acid metabolism
pon01100  Metabolic pathways
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04072  Phospholipase D signaling pathway
pon04217  Necroptosis
pon04270  Vascular smooth muscle contraction
pon04370  VEGF signaling pathway
pon04611  Platelet activation
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04724  Glutamatergic synapse
pon04726  Serotonergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04921  Oxytocin signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100173125 (PLA2G4A)
   00565 Ether lipid metabolism
    100173125 (PLA2G4A)
   00590 Arachidonic acid metabolism
    100173125 (PLA2G4A)
   00591 Linoleic acid metabolism
    100173125 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    100173125 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100173125 (PLA2G4A)
   04014 Ras signaling pathway
    100173125 (PLA2G4A)
   04370 VEGF signaling pathway
    100173125 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    100173125 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100173125 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100173125 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    100173125 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    100173125 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100173125 (PLA2G4A)
   04913 Ovarian steroidogenesis
    100173125 (PLA2G4A)
   04921 Oxytocin signaling pathway
    100173125 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100173125 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    100173125 (PLA2G4A)
   04726 Serotonergic synapse
    100173125 (PLA2G4A)
   04730 Long-term depression
    100173125 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100173125 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100173125 (PLA2G4A)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100173125 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 100173125
NCBI-ProteinID: NP_001126164
Ensembl: ENSPPYG00000000407
UniProt: Q5R8A5
LinkDB
Position
1
AA seq 749 aa
MSFIDPYQHIIVEHQYSHKFTVVVLCATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPVSSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYKAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcatttatagatccttaccagcacattatagtggagcaccagtattcccacaagttt
acggtagtggtgttatgtgccaccaaagtgacaaagggggcctttggtgacatgcttgat
actccagatccctatgtggaactttttatctctacaacccctgacagcaggaagagaaca
agacatttcaataatgacataaaccctgtgtggaatgagacctttgaatttattttggat
cctaatcaggaaaatgttttggagattacattaatggatgccaattatgtcatggatgaa
actctagggacagcaacatttcctgtatcttctatgaaggtgggagagaagaaagaagtt
ccttttattttcaaccaagtcactgaaatgattctagaaatgtctcttgaagtttgctca
tgccctgacctacgatttagtatggctctgtgtgatcaggagaagactttcagacaacag
agaaaagaacacataagggagagcatgaagaaactcttgggtccaaagaatagtgaagga
ttgcattctgcacgtgacgtgcctgtggtagccatattgggttcaggtgggggtttccga
gccatggtgggattctctggtgtgatgaaggcattatacgaatcaggaattctggattgt
gctacctacgttgctggtctttctggctccacctggtacatgtcaaccttgtattctcac
cctgattttccagagaaagggccagaggagattaatgaagaactaatgaaaaatgttagc
cacaaccccctcttacttctcacaccacagaaagttaaaagatatgttgagtctttatgg
aagaagaaaagctctggacaacctgtcacctttactgatatctttgggatgttaatagga
gaaacactaattcataatagaatgaatactactctgagtagtttgaaggaaaaagttaat
actgcacaatgccctttacctcttttcacctgtcttcatgtcaaacctgacgtttcagag
ctgatgtttgcagattgggttgaatttagtccatacgaaattggcatggctaaatatggt
acttttatggctcctgacttatttggaagcaaattttttatgggaacagtcgttaagaag
tatgaagaaaaccccttgcatttcttaatgggtgtctggggcagtgccttttccatattg
ttcaacagagttttgggcgtttctggttcacaaagcagaggctccacaatggaggaggaa
ttagaaaatattacaacaaagcatattgtgagtaatgatagctcggacagtgacgacgaa
tcacatgaacccaaaggcactgaaaatgaagatgctggaagtgactatcaaagtgataat
caagcaagttggattcatcgtatgataatggccttggtgagtgattcagctttattcaat
accagagaaggacgtgctgggaaggtacacaacttcatgctgggcttgaatctcaataca
tcttatccactgtctcctttgagtgactttgccacacaggactcctttgatgatgatgaa
ctggatgcagctgtagcagatcctgatgagtttgagcgaatatatgagcctctggatgtc
aaaagtaaaaagattcatgtagtggacagtgggctcacatttaacctgccgtatcccttg
atactgagacctcagagaggggttgatctcataatctcctttgacttttctgcaagacca
agtgactctagtcctccgttcaaggaacttctacttgcagaaaagtgggctaaaatgaac
aagctcccctttccaaagatcgatccttatgtgtttgatcgggaagggctgaaggagtgc
tatgtctttaaacccaagaatcctgatatggagaaagattgcccaaccatcatccacttt
gttctggccaacatcaacttcagaaagtacaaggctccaggtgttccaagggaaaccgag
gaagagaaagaaatcgctgactttgatatttttgatgacccggaatcaccattttcaacc
ttcaattttcaatatccaaatcaagcattcaaaagactacatgatcttatgcacttcaat
actctgaacaacattgatgtgataaaagaagccatggttgaaagcattgaatatagaaga
cagaatccatctcgttgctctgtttcccttagtaatgttgaggcaagaagatttttcaac
aaggagtttctaagtaaacccaaagcatag

KEGG   Pongo abelii (Sumatran orangutan): 100434495
Entry
100434495         CDS       T01416                                 

Gene name
PLA2G4C
Definition
(RefSeq) cytosolic phospholipase A2 gamma isoform X3
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon00590  Arachidonic acid metabolism
pon00591  Linoleic acid metabolism
pon00592  alpha-Linolenic acid metabolism
pon01100  Metabolic pathways
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04072  Phospholipase D signaling pathway
pon04217  Necroptosis
pon04270  Vascular smooth muscle contraction
pon04370  VEGF signaling pathway
pon04611  Platelet activation
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04724  Glutamatergic synapse
pon04726  Serotonergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04921  Oxytocin signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100434495 (PLA2G4C)
   00565 Ether lipid metabolism
    100434495 (PLA2G4C)
   00590 Arachidonic acid metabolism
    100434495 (PLA2G4C)
   00591 Linoleic acid metabolism
    100434495 (PLA2G4C)
   00592 alpha-Linolenic acid metabolism
    100434495 (PLA2G4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100434495 (PLA2G4C)
   04014 Ras signaling pathway
    100434495 (PLA2G4C)
   04370 VEGF signaling pathway
    100434495 (PLA2G4C)
   04072 Phospholipase D signaling pathway
    100434495 (PLA2G4C)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100434495 (PLA2G4C)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100434495 (PLA2G4C)
   04664 Fc epsilon RI signaling pathway
    100434495 (PLA2G4C)
   04666 Fc gamma R-mediated phagocytosis
    100434495 (PLA2G4C)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100434495 (PLA2G4C)
   04913 Ovarian steroidogenesis
    100434495 (PLA2G4C)
   04921 Oxytocin signaling pathway
    100434495 (PLA2G4C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100434495 (PLA2G4C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100434495 (PLA2G4C)
   04726 Serotonergic synapse
    100434495 (PLA2G4C)
   04730 Long-term depression
    100434495 (PLA2G4C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100434495 (PLA2G4C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100434495 (PLA2G4C)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100434495 (PLA2G4C)
SSDB
Motif
Pfam: PLA2_B Patatin
Other DBs
NCBI-GeneID: 100434495
NCBI-ProteinID: XP_009231116
LinkDB
Position
19
AA seq 528 aa
MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLSIEADEAPVVAVLGSGGGLRAHIACL
GVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSL
QKAIQAAKSENYSLTDFWAYMVISKHTRELSESHLSNMKKPVEEGTLPYPIFAAIDNDLQ
PSWQEARAPETWFEFTPHHAGFPALGAYVSITHFGSKFKKGRLVRTHPERDLTFLRGLWG
SALGNNEVIREYVFDQLRNLLTPRGLWRRAVANAKSIGRLIFARLLRLQESLQGEHPPPE
DEGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNFMDFVKKTGICASKWEWGT
THNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFE
TIRATTDYCRRHKIPFPQVEEAELDLWSKAPTSCYILKGETGPVVMHFPLFNIDACGGDI
EAWSDTYDTFKLADTYTLDVVVPLLALAKENVRENKKKILRELMNVAG
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgggaagctctgaggtttccataattcctgggctccagaaagaagaaaaggcggccgtg
gagagacgaagacttcatgtgctgaaagctctgaagaagctaagcattgaggccgatgag
gccccagttgttgctgtgctgggctcaggcggaggactgcgggctcacattgcctgcctt
ggtgtcctgagtgagatgaaagaacagggcctgttggatgctgtcacgtaccttgcaggg
gtctctggatccacttgggcaatatcttctctctacaccaacgatggggacatggaagct
ctcgaggctgacctgaaacatcgatttacccgacaggagtgggacttggctaagagccta
cagaaagccatccaagcagcgaagtctgagaattactctctgaccgacttctgggcctac
atggttatctccaagcacaccagagaactgtcagagtcccatttgtccaatatgaagaag
cccgtggaagaagggacactaccctacccgatatttgcagccattgacaatgacctgcaa
ccttcctggcaggaggcaagagcaccagagacctggttcgagttcacccctcaccacgct
ggcttccctgcactgggggcctatgtttccataacccacttcggaagcaaattcaagaag
ggaagactggtcagaactcaccctgagagagacctgactttcctgagaggtttatgggga
agtgctcttggtaacaatgaagtcattagggaatacgtttttgaccagttaaggaatctt
ctgaccccaagaggtttatggagaagggctgttgctaatgctaaaagcattggacgcctt
atttttgcccgattactgaggctgcaagaaagtttgcaaggggaacatcctcccccagaa
gatgaaggcggtgagcctgaacacacctggctgactgagatgctcgagaattggaccagg
acctccctggaaaagcaggagcagccccatgaggaccccgaaaggaaaggctcactcagt
aactttatggattttgtgaagaaaacaggcatttgcgcttcgaagtgggaatgggggacc
actcacaacttcctgtacaaacacggtggcatccgggacaagataatgagcagccggaag
cacctccacctggtggatgctggtttagccatcaacactcccttcccactcgtgctgccc
ccgacacgggaggttcacctcatcctctccttcgacttcagtgccggagatcctttcgag
accatccgggctaccactgactattgccgccgacacaagatcccctttccccaagtagaa
gaggctgagctggatttgtggtccaaggcccccaccagctgctacatcctgaaaggagaa
actggaccagtggtgatgcattttcccctgttcaacatagatgcctgtggaggtgatatt
gaggcatggagtgacacatacgacacattcaagctcgctgacacctacactctagatgtg
gtggtgccactcttggcattagccaaggagaacgtgagggaaaacaagaagaagatcctt
agagagttgatgaacgtggccgggtag

KEGG   Pongo abelii (Sumatran orangutan): 100447631
Entry
100447631         CDS       T01416                                 

Gene name
PLA2G4B
Definition
(RefSeq) cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon00590  Arachidonic acid metabolism
pon00591  Linoleic acid metabolism
pon00592  alpha-Linolenic acid metabolism
pon01100  Metabolic pathways
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04072  Phospholipase D signaling pathway
pon04217  Necroptosis
pon04270  Vascular smooth muscle contraction
pon04370  VEGF signaling pathway
pon04611  Platelet activation
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04724  Glutamatergic synapse
pon04726  Serotonergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04921  Oxytocin signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100447631 (PLA2G4B)
   00565 Ether lipid metabolism
    100447631 (PLA2G4B)
   00590 Arachidonic acid metabolism
    100447631 (PLA2G4B)
   00591 Linoleic acid metabolism
    100447631 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    100447631 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100447631 (PLA2G4B)
   04014 Ras signaling pathway
    100447631 (PLA2G4B)
   04370 VEGF signaling pathway
    100447631 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    100447631 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100447631 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100447631 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    100447631 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    100447631 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100447631 (PLA2G4B)
   04913 Ovarian steroidogenesis
    100447631 (PLA2G4B)
   04921 Oxytocin signaling pathway
    100447631 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100447631 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    100447631 (PLA2G4B)
   04726 Serotonergic synapse
    100447631 (PLA2G4B)
   04730 Long-term depression
    100447631 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100447631 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100447631 (PLA2G4B)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100447631 (PLA2G4B)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 100447631
NCBI-ProteinID: NP_001191153
LinkDB
Position
15
AA seq 781 aa
MALAEVSRTCLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVW
NQSFHFRIHRQLKNVVELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEG
RLEVEFHLQSLADRGEWLVSNGVLVARELSCLRVQLEETGDQKSSERRVQLVVPGSYEGP
QEASLGIGTFHFHCPACWEQELSIYLQDALEEQLKVPLSALPSGQVVRLVFPTSQEPLMR
VELKKEAGPRELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVIAIM
ATGGGIRAMTSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKNKLSVLAPSQLQRYRQELSERARLGYPSCFTNLWALINEALLHDEPHDHKLS
DQREALSHGQNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGQLMKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPL
LKIEEPPSTAGRIADFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGL
PNQLTPSEPHLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQQLQLLGRFCQE
QGIPFPPISPSPEEQLQPRECHTFSDPTCPRAPAVLHFPLVSDSFREYSAPGVRRTPEEA
AAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNVCNNREQLLEALRQAVQRRRQRRP
H
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctctggcagaggtgtccaggacctgcctgctcacggttcgtgtcctgcaggcccat
cgcctaccctctaaggacctagtgaccccctctgactgctacgtgactctctggctgccc
acggcctgcagccacaggctccagacacgcacagtcaagaacagcagtagccctgtctgg
aaccagagctttcacttcaggatccacaggcagctcaagaatgtcgtggaactgaaagtc
tttgaccaggacctggtgaccggagatgaccctgtgttgtcagtactgtttgatgcgggg
accctgcgggctggggagttccggcgcgagagcttctcactgagccctcagggtgagggg
cgcctggaagttgaatttcacctgcagagtctggctgaccgtggcgagtggctcgtcagc
aatggcgttctggtggcccgggagctctcctgcttgcgcgttcaactggaggagacagga
gaccagaagtcctcagagcgcagagttcagcttgtggttcctgggtcctatgagggtccg
caggaggcctctttgggcattggcaccttccacttccactgcccagcctgctgggagcag
gagctgagtatttacctgcaggatgccctcgaggagcaactaaaggtgccactgagtgcc
ctgccctctggccaagtggtgaggcttgtcttccccacgtcccaggagcccctgatgaga
gtggagctgaaaaaagaagcaggaccgagggagctggccgtgcgactgggcttcgggccc
tgtgcagaggagcaggccttcctgagcaggaggaagcaggtagtggccgcggccctgagg
caggccctgcagctggacggagacctgcaggaggatgagatcccagtgatagctattatg
gccactggtggtgggatccgggcaatgacttccctgtatgggcagctggctggcctgaag
gagctgggcctcttggattgcgtctcctatatcaccggggcctcaggctccacctgggcc
ttggccaacctttatgaggacccagagtggtctcagaaggacctggcagggcccactgag
ttgctgaagacccaggtgaccaagaacaagctgagtgtgctggcccccagccagctgcag
cggtaccggcaggagctgtccgagcgcgcccgcttgggctacccaagctgcttcaccaac
ctgtgggccctcatcaacgaggcactgctgcatgatgagccccatgaccacaagctctca
gatcaacgggaggccctgagtcacggccagaaccctctgcccatctactgtgccctcaac
accaaggggcagagcctgaccacttttgaatttggggagtggtgcgagttctctccctac
gaggtgggcttccccaagtacggggccttcatcccctctgagctctttggctccgagttc
ttcatggggcagctgatgaagaggcttcctgagtcccgcatctgcttcttagaaggtatc
tggagcaacctgtatgcagccaacctccaggacagcttatactgggcctcagagcccagc
cagttctgggaccgctgggtcaggaaccaggccaacctagacaaggagcaggtccccctt
ctgaagatagaagaaccaccctcaacagccggcaggatagctgactttttcactgatctt
ctgacgtggcgcccactggcccaggccacacataatttcctgcgtggcctccatttccac
aaagactactttcagcatcctcacttctccacatggaaagctaccactctggatgggctc
cccaaccagctgacaccctcggagcctcacctgtgcctgctggatgttggctacctcatc
aataccagctgcctgcccctcctgcagcctactcgggacgtggacctcatcctgtcattg
gactacaacctccacggagccttccagcagttgcagctcctgggccggttctgccaggag
caggggatcccgttcccgcccatctcgcctagccccgaagagcagctccagcctcgggag
tgccacaccttctccgaccccacctgccccagagcccctgcggtgctgcactttcccctg
gtcagcgactccttccgggagtactcggcccctggggtccggcggacacccgaggaggcg
gcggctggggaggtgaacctgtcttcgtcggactctccctaccactacacaaaggtgacc
tacagccaggaggacgtggacaagctgctgcacctgacacattacaatgtctgcaacaac
cgggagcagctgctggaggccctgcgccaggcggtgcagcggaggcggcagcgcagaccc
cactga

KEGG   Pongo abelii (Sumatran orangutan): 100448616
Entry
100448616         CDS       T01416                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon00590  Arachidonic acid metabolism
pon00591  Linoleic acid metabolism
pon00592  alpha-Linolenic acid metabolism
pon01100  Metabolic pathways
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04072  Phospholipase D signaling pathway
pon04217  Necroptosis
pon04270  Vascular smooth muscle contraction
pon04370  VEGF signaling pathway
pon04611  Platelet activation
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04724  Glutamatergic synapse
pon04726  Serotonergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04921  Oxytocin signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100448616 (PLA2G4F)
   00565 Ether lipid metabolism
    100448616 (PLA2G4F)
   00590 Arachidonic acid metabolism
    100448616 (PLA2G4F)
   00591 Linoleic acid metabolism
    100448616 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    100448616 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100448616 (PLA2G4F)
   04014 Ras signaling pathway
    100448616 (PLA2G4F)
   04370 VEGF signaling pathway
    100448616 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    100448616 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100448616 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100448616 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    100448616 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    100448616 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100448616 (PLA2G4F)
   04913 Ovarian steroidogenesis
    100448616 (PLA2G4F)
   04921 Oxytocin signaling pathway
    100448616 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100448616 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    100448616 (PLA2G4F)
   04726 Serotonergic synapse
    100448616 (PLA2G4F)
   04730 Long-term depression
    100448616 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100448616 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100448616 (PLA2G4F)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100448616 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 100448616
NCBI-ProteinID: XP_002825388
Ensembl: ENSPPYG00000006390
LinkDB
Position
15
AA seq 849 aa
MLWALWPRWLAGKMLPLLGAVLLQKREKKGPLWRHWRRETYPYYDLQVKVLRATNIRGTD
LLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDIL
GSDQLSLLLFDLRSLKCGQPHRHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLQGDGTAPREEYGSRQLQLAVPGAYEKPQLLPLQPATEPGLPPTFTFHVNPV
LSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSMKVEMSSGDLDLRLGFDLCDGEQEFLDRRKQVVSKALQQVLGLSEAPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
HAQVHVCSSKMGALSTERLQYYTQELGVRERSGHSVSLIDLWGLLVEYFLYQEENPAKLS
DQQEAVCQGQNPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF
MGRLLQLRPEPRICYLQGVWGSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQ
LHSPSRLRTRLLTPQGPFSQAVLDIFTSRFTSAQSFNFTRGLCLHKDYVAGREFVAWKDT
HPDAFPNQLTPMRDCLYLVDGGFAINSPFPLALLPQRAVDLILSFDYSLEAPFEVLKMTE
KYCLDRGIPFPSIEVGPEDMEEARECYLFAKAEDPRSPIVLHFPLVNCTFRTHLAPGVER
QTAEEKAFGDFAVNRPDTPYGMMNFTYEPHDFDRLVALSRYNVLNNVETLKCALQLALDR
HQARERAGG
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgctttgggcactctggccaaggtggctggcaggcaagatgctgcccctcctgggggca
gtgctgcttcagaagagagagaagaagggccctctgtggaggcactggcggcgggaaacc
tacccatactatgacctccaggtgaaggtgctgagggccacaaacatccggggtacagac
ctgctatccaaagccgactgctatgtgcaactgtggctgcccacggcgtcccccagccct
gcccagacgaggatagtggccaactgcagtgaccccgagtggaatgagaccttccactac
cagatccatggtgctgtgaagaacgtcctggagctcaccctctatgacaaggacatcctg
ggcagcgaccagctctccctgctcctgtttgacctaaggagcctcaagtgtggccaacct
cacagacacaccttcccactcaaccaccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaagtcatcaccaacggggttctggtggctcac
ccctgtctgagaatccagggcacgctccagggagatgggacagccccacgggaagagtac
ggctctaggcagctccagctggcagtgcctggggcctacgagaagccacagctcttgccc
ctgcagcctgccacagagccaggccttccacccacctttaccttccacgtgaacccagtg
ctgagctccaggctacacgtagagctgatggagctgctggcggctgtgcagagtggcccc
agtgcagagctggaggctcagaccagcaagctgggcgaggggggcatcctgctctcctct
ctgcccctaggccaggaggaacagtgttctgtggccctgggggagggccaggaggtggct
ctgagtatgaaggtggaaatgagctccggggacctagacctacgccttggctttgacctc
tgtgacggggagcaggagtttctggacaggaggaagcaggtcgtgtccaaggccctgcag
caggtgctgggattgagtgaggctccggacagtggccaggtgccagtagtggctgtgttg
ggttctgggggtggaacccgagccatgtcttctctgtacggcagcctggcagggttgcag
gagctcggccttctagacactgtgacctacctgagtggggtctctgggtccacctggtgc
atctccacactctacagggacccagcctggtcccaggtggccttgcagggccccattgag
catgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggagcggctacag
tactacactcaggaactgggggtccgggagcgcagtggccacagcgtgtccctcatcgac
ctctggggcctccttgtggagtatttcctgtaccaggaggagaaccctgccaagctatct
gaccaacaggaggcggtctgccagggtcagaacccttaccccatttacaccagcgtcaac
gtccgcaccaacttaagtggagaagattttgcagagtggtgtgagttcacaccctatgag
gtcggcttccccaagtatggggcttatgttcccaccgagctctttggctcagaactcttc
atgggacgattgctgcagctccggcctgaaccccggatctgttacctgcaaggtgtgtgg
ggtagcgcctttgccaccagcctggatgagatcttcctaaagaccgctggctcaggcctc
agcttcctggagtggtacagaggcagtgtgaatatcacagacgactgccagaagcctcag
ctgcacagcccctcgaggctgcgaacaaggctcctcaccccgcaggggcccttctcccag
gctgtgctggacatattcacctcccgcttcacttccgcccagagctttaacttcacccgg
ggtctctgcttgcacaaggactatgtggctggcagggagttcgtggcctggaaagacaca
cacccagatgccttccccaaccagctcacccccatgcgggactgcctgtacctggtggac
ggaggctttgccatcaactctccattcccactggctctgctgcctcagagagcggtggac
ctcattctgtccttcgactattccttggaagccccttttgaggtcttgaagatgacagag
aagtactgcctggaccgaggaatccccttccctagcatcgaggtgggccctgaagacatg
gaggaggcccgtgagtgctatctgtttgccaaggctgaggacccccgctcccccattgtg
ctgcacttcccccttgttaactgtaccttccgcacacacctggccccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttgccgtcaacaggccagacaccccctat
ggcatgatgaacttcacctatgagcctcatgactttgatcggctggtggccctcagtcga
tacaacgttctgaacaatgtggagaccttgaagtgcgccctccagctggctctggaccgg
caccaggctcgggagagggcagggggctga

KEGG   Pongo abelii (Sumatran orangutan): 100454614
Entry
100454614         CDS       T01416                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon00590  Arachidonic acid metabolism
pon00591  Linoleic acid metabolism
pon00592  alpha-Linolenic acid metabolism
pon01100  Metabolic pathways
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04072  Phospholipase D signaling pathway
pon04217  Necroptosis
pon04270  Vascular smooth muscle contraction
pon04370  VEGF signaling pathway
pon04611  Platelet activation
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04724  Glutamatergic synapse
pon04726  Serotonergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04921  Oxytocin signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100454614 (PLA2G4E)
   00565 Ether lipid metabolism
    100454614 (PLA2G4E)
   00590 Arachidonic acid metabolism
    100454614 (PLA2G4E)
   00591 Linoleic acid metabolism
    100454614 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    100454614 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454614 (PLA2G4E)
   04014 Ras signaling pathway
    100454614 (PLA2G4E)
   04370 VEGF signaling pathway
    100454614 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    100454614 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100454614 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100454614 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    100454614 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    100454614 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100454614 (PLA2G4E)
   04913 Ovarian steroidogenesis
    100454614 (PLA2G4E)
   04921 Oxytocin signaling pathway
    100454614 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100454614 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    100454614 (PLA2G4E)
   04726 Serotonergic synapse
    100454614 (PLA2G4E)
   04730 Long-term depression
    100454614 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100454614 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100454614 (PLA2G4E)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100454614 (PLA2G4E)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 100454614
NCBI-ProteinID: XP_002825400
Ensembl: ENSPPYG00000006388
LinkDB
Position
15
AA seq 868 aa
MSLQASEGCAGLGTNVFVTQSPQRDDEGSRSGRSFSEFEDTQDLDTPGLPPFCPMAPWGS
EEGLSPCHLLTVRVIRMKNVRQADMLSQTDCFVSLWLPTASQKKLRTRTISNCPNPEWNE
NFNFQIQSRVKNVLELSVCDEDTMTPDDHLLTVLYDLTKLCFRKKTHVKFPLNPQGMEEL
EVEFLLEESPSPPETLVTNGVLVSRQVSRLEVHAQSRRRRKREKMKDLLVMVNESFENTQ
RVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCCCSRKNGPISQPLD
CLSDGQVMTLPVGESYELHMKSTPCPETLDVRLGFSLCPAELEFLQKRKMVVAKALKQVL
QLEEDLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMAT
LYRDPDWSSKNLEPAIFEARRHVVKDKLPSLFPEQLRKFQEELRQRSQEGYRVTFTDFWG
LLIETCLGDERNECKLSDQRAALSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGL
QKYGAFIPSELFGSEFFMGRLVKRIPESRICYMLGLWSSIFSLNLLDAWNLSHTSEEFFH
RWTREKVQDIEDEPILPEIPKCDANILETTVVIPGSWLSNSFREILTHRSFVSEFHNFLS
GLQLHTNYLQNGQFSRWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPLLRPERKAD
LIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPNAPIVT
FFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEATFDKLVKLSEYN
ILNNKDTLLQALRLAVEKKKRLKGQCPS
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgagtctccaggcctcggaaggctgtgctggcctgggaactaatgtgtttgtcacacag
agcccacaaagggatgacgaaggcagcaggtcaggaagaagtttcagtgagttcgaggat
acacaggacctggacactcctggtctcccacctttctgtcctatggctccttggggctct
gaggaggggctgtctccatgccacctgttgacagtgcgggtcatccggatgaaaaatgtc
cggcaggctgatatgctgagccagacagactgttttgtgagcctctggctgcccactgcc
tctcagaagaagctgaggacaaggaccatctccaactgcccaaatccagagtggaatgaa
aacttcaacttccagatccagagccgagtgaagaacgtgctagagttgagtgtctgtgat
gaagacacaatgacaccagatgaccatctcctgacagttctctatgacctcaccaagctc
tgtttccgaaagaaaacccatgtgaagtttccactcaacccgcagggcatggaagagctg
gaggtggagttcctgctggaggagagtccctctccacctgagaccctcgtcaccaatggc
gtgctggtgtctcgacaagtctcccgcctggaggttcatgcacaatccaggaggcggagg
aagagggagaaaatgaaggacctcctggtgatggtgaacgagtcctttgagaacacccag
cgtgtccggccctgcttggaaccctgctgcccaacctctgcctgcttccaaaccgctgcc
tgcttccactaccccaagtacttccagtcccaggtgcacgtggaagtgcccaagagtcac
tggagctgtgggctttgctgctgctctcgcaagaacggccccatcagccagcccctcgac
tgcctttccgatggtcaggtgatgaccctgcctgtgggtgagagttatgaattacacatg
aagtctacaccctgccctgagacactggacgtgcgactgggcttcagcctgtgcccagca
gagctggagtttctgcagaagcggaagatggtggtggccaaggccctgaagcaggtgctg
cagttggaggaagacctgcaggaggacgaggtgccgctgatagctatcatggccactggg
ggtggaacaagatccatgacctccatgtatggccacctgctggggctgcagaagctgaac
ctcctggactgtgccagctacatcactggcctgtcaggggccacctggaccatggctacc
ttgtaccgtgaccctgactggtcctccaaaaacttggagcctgctatctttgaggcccgg
agacatgtagtaaaggacaagctaccctccctgttcccagagcagctccgcaaattccag
gaggagctccggcagcgcagccaggaaggctacagggtcacctttacagacttctggggc
ctgctgatagagacctgtctgggggacgagagaaatgaatgcaaactgtcagatcagcgt
gctgctttgagctgcggccagaaccccctgcccatctacctcaccatcaatgtcaaggat
gatgtaagcaaccaggacttcagagagtggttcgagttctccccctacgaggtgggcctg
cagaagtatggggccttcatcccatccgagctcttcggctccgagttcttcatggggcgg
ctggtgaagaggatcccggagtctcgaatctgctacatgctaggcctgtggagcagcatc
ttctccctgaacctgctggatgcctggaacctgtcacacacctcggaggagtttttccac
aggtggacaagggagaaagtgcaggacatcgaagacgagccaatcctgcctgaaatcccc
aaatgtgatgctaacatcctagagaccacggtagtgatcccagggtcatggctgtccaat
tctttccgagaaatccttacccatcggtccttcgtgtctgagtttcacaacttcctgtct
gggctgcagctgcacaccaactacctccagaatggccagttctctaggtggaaagacaca
gtgctggatggtttcccaaaccagctgacggagtccgcgaaccacctgtgcctgctggac
actgcgttctttgtcaactccagctacccgcccctcctcaggccagagcgaaaagccgac
ctcatcatccacctcaactactgtgctgggtcccagacaaagcccctgaaacaaacttgt
gagtactgcactgtgcagaacatccccttccccaaatacgagctgccagatgagaacgaa
aatctcaaggaatgctacctgatggagaacccccaggaacccaatgcccccatcgtgact
ttcttcccactcatcaatgatactttccgaaaatacaaggcaccaggtgtagagcgaagc
cctgaggagctggagcagggccaggtggacatttatggtcccaaaactccctatgccacc
aaggagctgacgtacacagaggccacctttgacaagctggtgaaactctcagagtacaac
atcctgaataataaggacactctcctccaggctctgcggcttgcagtggagaagaagaag
cgcctgaagggccagtgtccctcctag

KEGG   Pongo abelii (Sumatran orangutan): 100454977
Entry
100454977         CDS       T01416                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon00590  Arachidonic acid metabolism
pon00591  Linoleic acid metabolism
pon00592  alpha-Linolenic acid metabolism
pon01100  Metabolic pathways
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04072  Phospholipase D signaling pathway
pon04217  Necroptosis
pon04270  Vascular smooth muscle contraction
pon04370  VEGF signaling pathway
pon04611  Platelet activation
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04724  Glutamatergic synapse
pon04726  Serotonergic synapse
pon04730  Long-term depression
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04921  Oxytocin signaling pathway
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100454977 (PLA2G4D)
   00565 Ether lipid metabolism
    100454977 (PLA2G4D)
   00590 Arachidonic acid metabolism
    100454977 (PLA2G4D)
   00591 Linoleic acid metabolism
    100454977 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    100454977 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454977 (PLA2G4D)
   04014 Ras signaling pathway
    100454977 (PLA2G4D)
   04370 VEGF signaling pathway
    100454977 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    100454977 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100454977 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100454977 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    100454977 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    100454977 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100454977 (PLA2G4D)
   04913 Ovarian steroidogenesis
    100454977 (PLA2G4D)
   04921 Oxytocin signaling pathway
    100454977 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100454977 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    100454977 (PLA2G4D)
   04726 Serotonergic synapse
    100454977 (PLA2G4D)
   04730 Long-term depression
    100454977 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100454977 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100454977 (PLA2G4D)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100454977 (PLA2G4D)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 100454977
NCBI-ProteinID: XP_024088540
Ensembl: ENSPPYG00000006389
LinkDB
Position
15
AA seq 818 aa
MESLSPGGPPGHPYQGEASACWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFK
TKTLTDTSHPVWNEAFRFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDISEVLPGKLL
RKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVLVARELSCLDVHLDSTGSTAVVADQ
DKLELELVLKGSYEDTQTSFLGTASAFCFHYMTALETELSGRLRSSTSNGWNGDNSAGYL
TVPLRPLTTGKEVTMDVPAPNAPAVRLQLKAEGCPEELAVHLGFNLCAEEQAFLSRRKQV
VAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDPEWSQRDLEGPIRYAREHLAKSKLEVFSPERLASYRRELELRAEQGH
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWY
DLTSSGESWKQHIKDKTRSLEKEPLITSGTSSQLEASWLQPGTALAQAFKGFLTGRPLHQ
RSPNFLQGLQLHQDYCSNKDFSTWADCQLDSMPSQLTPQEPRLCLVDAGYFINTSCPSMF
RPGRRLDLILSFDYSLSAPFEALQQTELYCRVRGLPFPRVEPSPQDQHQPRECHLFSDPV
CPEAPILLHFPLVNASFKDHLAPGVQRSPAELQAGQVDLTGATCPYTLSNMTYKEEDFER
LLWLSNYNVQTSQGAILQALRTALKHRTLEARPPRAQT
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggagagcctgtcacctgggggaccacctggccacccttaccagggggaggcctctgcc
tgctggcagctcaccgtgagggtcctggaggcgcggaacctgcgctgggctgacctgttg
agtgaggccgacccttacgtgatcctacagctgtcgactgcgcctggaatgaagtttaag
accaagacgctcaccgacaccagtcatcctgtgtggaatgaggccttccgtttccttatc
caaagtcaggtcaagaatgttctggagcttagcatctatgatgaggactcagtcacggag
gatgacatctgcttcaaggttctctacgacatctcagaagtcctccctggcaagctgctc
cggaaaaccttctcccagagtccccagggagaggaggagctggatgtggagttcctgatg
gaagaaacgtcagatcgcccagaaaacctcatcaccaacaaagtccttgtggcccgagag
ctgtcatgcctggatgtgcatctggacagcacagggagcaccgctgtggttgcagatcag
gacaagctggagctggagctggtgctgaaggggtcctatgaggacacacagacatccttc
ctgggcacagcctctgccttctgcttccactacatgacagccctagagacagagctgagc
gggcgcctgaggagctccacaagcaatggctggaatggggacaactcagctgggtacctc
actgtgcccctgaggcccttgaccactgggaaggaggtgaccatggatgttcctgctcca
aatgccccagcagtgaggctgcagctcaaggcagagggctgccctgaggagctggccgtg
cacctgggcttcaatctctgtgcagaggagcaggccttcctgagcaggaggaagcaggtg
gtggccaaggccctgaagcaggccctgcagctggacagagacctccaggaggacgaggta
cccgtcgtgggcatcatggccacaggaggaggtgcccgggccatgacatctctgtacggc
cacctattggccttgcagaagctgggcctcctggactgtgtgacctacttcagtggcatc
tctggctctacgtggacaatggcccacctgtacggggaccctgagtggtcgcagagggac
ctggagggacctatcagatacgcccgggagcacctggccaagagcaagctggaggtcttt
tccccagagcgtctggcgagctaccgccgggagctggagctgcgggctgagcagggccac
cccacgacctttgtggacctgtgggcgctagtgctggagtccatgctgcacggccaggtg
atggatcagaagctgtcaggacagagagccgccctggaacggggtcagaaccctctgccc
ctctacttgagcctcaatgtcaaagagaacaatctggagacactggacttcaaggagtgg
gttgagttctccccctatgaggtcgggttcctgaagtacggagccttcgtccctcctgag
ctctttggctctgagttcttcatgggacgactgatgaggaggatcccggagccccggatc
tgctttctggaagccatctggagcaacattttctccctgaacctgctggacgcctggtat
gacctcaccagttctggggagtcctggaaacagcacatcaaggacaagaccaggagctta
gagaaggagcccctgatcacctcggggacctcctcgcagctggaggcttcgtggctgcag
ccgggcacggcgctggcccaggcatttaaaggcttcctgactggcaggcccctccaccag
cgcagccccaacttcctccagggcctccagctgcaccaggactactgtagcaacaaggac
ttctccacctgggcagactgccagcttgactccatgcccagccagctgaccccccaggag
ccccggctctgcctggtggacgctggctacttcatcaacaccagctgtccctccatgttc
cggccgggccgcaggctggacctcatcctctccttcgactactccctatctgcgcccttc
gaggcgctgcagcagacggagctgtactgcagggtccgggggctgcccttcccccgggtg
gaacccagccctcaggaccagcatcagccaagggagtgccacctcttctcagaccccgtc
tgccctgaggctccgatcctgctgcacttcccgctggtcaatgcctccttcaaggaccac
ttagcccctggtgtccagcgcagccccgcagagctccaggctggccaagtggatctcacc
ggggccacctgcccctacaccctgtccaacatgacctacaaggaggaagacttcgagcgc
ctgctgtggctcagcaactacaacgtgcagaccagccagggtgccatcctgcaggccctg
aggaccgcgctgaagcaccggaccctagaggcgaggcctccaagggcacagacctga

DBGET integrated database retrieval system