KEGG   Pongo abelii (Sumatran orangutan): 100173225
Entry
100173225         CDS       T01416                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1
  KO
K06279  SHC-transforming protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04510  Focal adhesion
pon04650  Natural killer cell mediated cytotoxicity
pon04722  Neurotrophin signaling pathway
pon04910  Insulin signaling pathway
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04926  Relaxin signaling pathway
pon04935  Growth hormone synthesis, secretion and action
pon05034  Alcoholism
pon05100  Bacterial invasion of epithelial cells
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05220  Chronic myeloid leukemia
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100173225 (SHC1)
   04014 Ras signaling pathway
    100173225 (SHC1)
   04072 Phospholipase D signaling pathway
    100173225 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100173225 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100173225 (SHC1)
   04062 Chemokine signaling pathway
    100173225 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100173225 (SHC1)
   04915 Estrogen signaling pathway
    100173225 (SHC1)
   04917 Prolactin signaling pathway
    100173225 (SHC1)
   04926 Relaxin signaling pathway
    100173225 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    100173225 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100173225 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100173225 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100173225 (SHC1)
   05226 Gastric cancer
    100173225 (SHC1)
   05214 Glioma
    100173225 (SHC1)
   05220 Chronic myeloid leukemia
    100173225 (SHC1)
   05224 Breast cancer
    100173225 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    100173225 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100173225 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100173225 (SHC1)
   01522 Endocrine resistance
    100173225 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100173225
NCBI-ProteinID: NP_001126253
Ensembl: ENSPPYG00000000769
UniProt: Q5R7W7
LinkDB
Position
1
AA seq 583 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLRDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAAPGAARSTAPSAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRE
LFDDPSYVNVQNLDKARQAVGGAGPPNPAVNGSAPRDLFDMRPFEDALRVPPPPQSVSMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLIGYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaatccactccggaatgagtctctgtcatcg
ctggaggaaggggcttctgggtccacccccccggaggagctgccttctccatcagcttca
tccctggggcccatcctgcctcctctgcctggggacgatagtcccactaccctgtgctcc
ttcttcccccggatgagcaacctgaggctggccaacccggctggggggcgcccagggtct
aagggggagccaggaagggcagccgatgatggggaggggatcgtaggggcagccatgcca
gactcaggccccctacccctcctccgggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacttggttcggtacatgggctgtgtggaggtccttcagtcaatgcgtgccctggac
ttcaacacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcaacgaggaggagaaagccctgtagccgcccgctcagctctatcctg
gggaggagtaacctgaaatttgctggaatgccaatcactctcaccgtctccaccagcagc
ctcaacctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcaatctatc
tcatttgcatccggcggggatccggacacagccgagtatgtcgcctacgttgccaaagac
cctgtgaatcagagagcctgccacattctggagtgtcccgaagggcttgcccaggatgtc
atcagcaccattggccaggccttcgagttgcgcttcaaacaatacctcaggaacccaccc
aaactggtcacccctcatgacaggatggctggctttgatggctcagcatgggatgaggag
gaggaagagccacctgaccatcagtactataatgacttcccggggaaggaaccccccctg
gggggggtggtagacatgaggcttcgggaaggagccgctccaggggctgctcgatccacc
gcacccagtgcccagacccccagccacttgggagctacactgcctgtaggacagcctgtt
gggggagatccagaagtccgcaaacagatgccacctccaccaccctgtccaggtagagag
ctctttgatgatccctcctatgtcaacgtccagaacctagacaaggcccggcaagcagtg
ggtggtgctgggccccctaatcctgctgtcaatggcagtgcaccccgggacctgtttgac
atgaggcccttcgaagatgctcttcgggtgcctccacctccccagtcggtgtccatggct
gagcagctccgaggggagccctggttccacgggaagctgagccggcgggaggctgaggca
ctgctgcagctcaacggggacttcctggtgcgggagagcacgaccacacctggccagtat
gtgctcactggcttgcagagtgggcagcccaagcatttgctactggtggaccctgagggt
gtggttcggactaaggatcaccgctttgagagtgtcagtcaccttatcggctaccacatg
gacaatcacttgcccatcatctctgcgggcagcgaactgtgtctacagcaacctgtggag
cggaaactgtga

DBGET integrated database retrieval system