KEGG   Pongo abelii (Sumatran orangutan): 100173260
Entry
100173260         CDS       T01416                                 

Gene name
PPP2R1A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04350  TGF-beta signaling pathway
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon05142  Chagas disease
pon05160  Hepatitis C
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100173260 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100173260 (PPP2R1A)
   04390 Hippo signaling pathway
    100173260 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    100173260 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    100173260 (PPP2R1A)
   04152 AMPK signaling pathway
    100173260 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100173260 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100173260 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100173260 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    100173260 (PPP2R1A)
   04730 Long-term depression
    100173260 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100173260 (PPP2R1A)
   05165 Human papillomavirus infection
    100173260 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100173260 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100173260 (PPP2R1A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100173260 (PPP2R1A)
   03036 Chromosome and associated proteins [BR:pon03036]
    100173260 (PPP2R1A)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100173260 (PPP2R1A)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100173260 (PPP2R1A)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100173260 (PPP2R1A)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 CLASP_N Adaptin_N M11L TAF6_C Spore_Cse60
Other DBs
NCBI-GeneID: 100173260
NCBI-ProteinID: NP_001126285
Ensembl: ENSPPYG00000010336
UniProt: Q5R7R5
LinkDB
Position
19
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVARDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYLRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILDKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggcggccgacggcgacgactcgctgtaccccatcgcggtgctcatagacgaactc
cgcaatgaggacgttcagcttcgcctcaacagcatcaagaagctgtccaccattgccttg
gcccttggggtcgaaaggacccgaagtgagcttctgcctttccttacagataccatctat
gatgaagatgaggtcctcctggccctggcagaacagctgggaaccttcactaccctggtg
ggaggcccagagtacgtgcactgcctgctgccaccgctggagtcgctggccacagtggag
gagacagtggcgcgggacaaggcagtggagtccttacgggccatctcacacgagcactcg
ccctctgacctggaggcgcactttgtgccgctagtgaagcggctggcgggcggcgactgg
ttcacctcccgcacctcggcctgcggcctcttctccgtctgctacctccgagtgtccagt
gctgtcaaggcggaacttcgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgcagcctccaagctgggggagtttgccaaggtgctggagctggacaac
gtcaagagtgagatcatccccatgttctccaacctggcctctgacgagcaggactcggtg
cggctgctggcggtggaggcgtgcgtgaacatcgcccagcttctgccccaggaggatctg
gaggccctggtgatgcccactctgcgccaggctgctgaagacaagtcctggcgcgtccgc
tacatggtggctgacaagttcacagagctccagaaagcagtggggcctgagatcaccaag
acagacctggtccccgccttccagaacctgatgaaagactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagagttctgtgaaaacctctcagctgattgtcgggagaat
gtgatcatgtcccagatcttgccttgcatcaaggagctggtgtccgatgccaaccaacat
gtcaagtctgccctggcctcagtcatcatgggtctgtctcccatcttggacaaagacaac
accatcgagcacctcttgcccctcttcctggctcagctgaaggatgagtgccctgaggta
cggctgaacatcatctctaacctggactgtgtgaacgaggtgattggcatccggcagctg
tcccagtccctgctccctgccattgtggagctggctgaggacgccaagtggcgggtgcgg
ctggccatcattgagtacatgcccctcctggctggacagctgggagtggagttctttgat
gagaaacttaactccttgtgcatggcctggcttgtggatcatgtatatgccatccgcgag
gcagccaccagcaacctgaagaagctagtggaaaagtttgggaaggagtgggcccatgcc
acaatcatccccaaggtcttggccatgtccggagaccccaactacctgcaccgcatgact
acgctcttctgcatcaatgtgctgtctgaggtctgtgggcaggacatcaccaccaagcac
atgctgcccacggttctgcgcatggctggggacccagttgccaatgtccgcttcaatgtg
gccaagtctctgcagaagatagggcccatcctggacaacagcaccctgcagagtgaagtc
aagcccatcctagagaagctcacccaggaccaggatgtggatgtcaaatactttgcccag
gaggctttgactgttctatctctcgcctga

KEGG   Pongo abelii (Sumatran orangutan): 100173941
Entry
100173941         CDS       T01416                                 

Gene name
PPP2R5C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04728  Dopaminergic synapse
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100173941 (PPP2R5C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100173941 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    100173941 (PPP2R5C)
   04152 AMPK signaling pathway
    100173941 (PPP2R5C)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100173941 (PPP2R5C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100173941 (PPP2R5C)
  09156 Nervous system
   04728 Dopaminergic synapse
    100173941 (PPP2R5C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100173941 (PPP2R5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100173941 (PPP2R5C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100173941 (PPP2R5C)
   03036 Chromosome and associated proteins [BR:pon03036]
    100173941 (PPP2R5C)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100173941 (PPP2R5C)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100173941 (PPP2R5C)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100173941 (PPP2R5C)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 100173941
NCBI-ProteinID: NP_001126924
UniProt: Q5R4P5
LinkDB
Position
14
AA seq 410 aa
MVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQ
LVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLG
LRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLH
KVKSLSVYHPQLAYCVVQFLGKDSTLTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVI
EPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLY
RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN
LAKANPQAQKDPKKDRPLARRKSELPQDPHTKKALEAHCRADELASQDGR
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggtagagtatatcacccataatcggaatgtgatcacagagcctatttacccagaagta
gtccatatgtttgcagttaacatgtttcgaacattaccaccttcctccaatcctacggga
gcggaatttgacccagaggaagacgaaccaacgttagaagcagcctggcctcatctacag
cttgtttatgaatttttcttaagatttttagagtctccagatttccaacctaatatagcg
aagaaatatattgatcagaagtttgtattgcagcttttagagctctttgacagtgaagat
cctcgggagagagattttcttaaaaccacccttcacagaatctatgggaaattcctaggc
ttgagagcttacatcagaaaacagataaataatatattttataggtttatttatgaaaca
gagcatcataatggcatagcagagttactggaaatattgggaagtataattaatggattt
gccttaccactaaaagaagagcacaagattttcttattgaaggtgttactacctttgcac
aaagtgaaatctctgagtgtctaccatccccagctggcatactgtgtagtgcagttttta
ggaaaggacagcaccctcacggaaccagtggtgatggcacttctcaaatactggccaaag
actcacagtccaaaagaagtaatgttcttaaacgaattagaagagattttagatgtcatt
gaaccatcagaatttgtgaagatcatggaacccctcttccggcagttggccaaatgtgtc
tccagcccacacttccaggtggcagagcgagctctctattactggaataatgaatacatc
atgagtttaatcagtgacaacgcagcgaagattctgcccatcatgtttccttccttatac
cgcaactcaaagacccattggaacaagacaatacatggcttgatatacaacgccctgaaa
ctcttcatggagatgaaccaaaagctatttgatgactgtacacaacagttcaaagcagag
aaactaaaagagaagctaaaaatgaaagaacgagaagaagcatgggttaaaatagaaaat
ctagccaaagccaatccccaggcacagaaagatccgaagaaggaccgtcctcttgcacgc
cgcaagtccgagctgcctcaggacccccacaccaagaaagccttggaagctcactgcagg
gccgatgagctggcctcccaggacggccgctag

KEGG   Pongo abelii (Sumatran orangutan): 100174027
Entry
100174027         CDS       T01416                                 

Gene name
PPP2R2B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon04728  Dopaminergic synapse
pon05142  Chagas disease
pon05160  Hepatitis C
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100174027 (PPP2R2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100174027 (PPP2R2B)
   04071 Sphingolipid signaling pathway
    100174027 (PPP2R2B)
   04151 PI3K-Akt signaling pathway
    100174027 (PPP2R2B)
   04152 AMPK signaling pathway
    100174027 (PPP2R2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100174027 (PPP2R2B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100174027 (PPP2R2B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100174027 (PPP2R2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100174027 (PPP2R2B)
   05165 Human papillomavirus infection
    100174027 (PPP2R2B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100174027 (PPP2R2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100174027 (PPP2R2B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100174027 (PPP2R2B)
   03036 Chromosome and associated proteins [BR:pon03036]
    100174027 (PPP2R2B)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100174027 (PPP2R2B)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100174027 (PPP2R2B)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100174027 (PPP2R2B)
SSDB
Other DBs
NCBI-GeneID: 100174027
NCBI-ProteinID: NP_001259029
UniProt: Q5R4A2 A0A2J8VNP3
LinkDB
Position
5
AA seq 446 aa
MKCFSRYLPYIFRPPNTILSSSCHTEADIISTVEFNHTGELLATGDKGGRVVIFQREQES
KNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKL
WKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHIN
SISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNT
FVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIM
TRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGS
YNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILH
TAWHPSENIIAVAATNNLYIFQDKVN
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaaatgcttctctcgttacctgccttacatcttcagacctccgaacaccatcctttct
tccagctgccacacagaagctgacattatctctacggtagaattcaaccacacgggagaa
ttactagcgacaggggacaaggggggtcgggttgtaatatttcaacgagagcaggagagt
aaaaatcaagttcatcgtaggggtgaatacaatgtttacagcacattccagagccatgaa
cctgagttcgattacctgaagagtttagaaatagaagaaaaaatcaataaaataagatgg
ctcccccagcagaatgcagcttactttcttctgtctactaatgataaaactgtgaagctg
tggaaagtcagcgagcgtgataagaggccagaaggctacaatctgaaagatgaggagggc
cggctccgggatcctgccaccatcacaaccctgcgggtgcctgtcctgagacccatggac
ctgatggtggaggccaccccacgaagagtatttgccaacgcacacacatatcacatcaac
tccatatccgtcaacagcgactatgaaacctacatgtctgctgatgacctgaggattaac
ctttggaactttgaaataaccaatcaaagttttaatattgtggatattaagccagccaac
atggaggagctcacggaagtgatcacagcagccgagttccacccccatcattgcaacacc
ttcgtgtacagcagcagcaaagggacaatccggctgtgtgacatgcgggcatctgccctg
tgtgacaggcacaccaaattttttgaagagccggaagatccaagcaacagatcatttttc
tctgaaattatctcttcgatttcggatgtgaagttcagccacagtgggaggtatatcatg
accagggactatttgaccgttaaagtctgggatctcaacatggaaaaccgccccatcgag
acttaccaggttcatgactacctccgcagcaagctgtgttccctctatgaaaatgactgc
atttttgataaatttgagtgtgtgtggaatgggtcagacagtgtcatcatgacgggctcc
tacaacaacttcttcaggatgttcgacagaaacaccaagcgtgatgtgacccttgaggct
tcgagggaaaacagcaagccccgggctatcctcaaaccccgaaaagtgtgtgtggggggc
aagcggagaaaagacgagatcagtgttgacagtctggactttagcaaaaagatcttgcat
acagcttggcatccttcagaaaatattatagcagtggcggctacaaataacctatatata
ttccaggacaaggttaactag

KEGG   Pongo abelii (Sumatran orangutan): 100433271
Entry
100433271         CDS       T01416                                 

Gene name
PPP2R5D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04728  Dopaminergic synapse
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100433271 (PPP2R5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100433271 (PPP2R5D)
   04151 PI3K-Akt signaling pathway
    100433271 (PPP2R5D)
   04152 AMPK signaling pathway
    100433271 (PPP2R5D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100433271 (PPP2R5D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100433271 (PPP2R5D)
  09156 Nervous system
   04728 Dopaminergic synapse
    100433271 (PPP2R5D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100433271 (PPP2R5D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100433271 (PPP2R5D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100433271 (PPP2R5D)
   03036 Chromosome and associated proteins [BR:pon03036]
    100433271 (PPP2R5D)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100433271 (PPP2R5D)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100433271 (PPP2R5D)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100433271 (PPP2R5D)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 100433271
NCBI-ProteinID: XP_009240164
Ensembl: ENSPPYG00000016625
UniProt: A0A2J8Y4E8
LinkDB
Position
6
AA seq 602 aa
MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGDNTEEAQPQPQPQPQPQAQSQPPSSNKRPS
NSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQ
KLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLF
RTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFV
LALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAEL
LEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEP
VIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE
RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKL
FDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPT
AEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQE
AL
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgccctataaactgaaaaaggagaaggagccccccaaggttgccaaatgcacagccaag
cctagcagctcaggcaaggatggtggaggcgacaacactgaggaggcccagccgcagccc
cagccccagccccagccccaagcccagtctcagccaccgtcgtccaacaagcgtcccagc
aatagcacgccaccccccacgcagctcagcaaaatcaagtactcaggggggccccagatt
gtcaagaaggagcgacggcaaagctcctcccgcttcaacctcagcaagaatcgggagctg
cagaagcttcctgccctgaaagattcgccaacccaggagcgggaggagctgtttatccag
aagctacgccagtgctgtgtcctctttgacttcgtgtcagacccactcagtgacctcaaa
ttcaaggaggtgaagcgggcaggactcaacgagatggtggagtacatcacccatagccgt
gatgttgtcactgaggccatttaccctgaggctgtcaccatgttttcagtgaacctcttc
cggacgctgccaccttcgtcgaatcccacaggggctgagtttgacccagaggaagatgag
cccaccctggaagctgcttggccacatctccagctcgtgtatgagttcttcttacgtttc
cttgagtctcctgatttccagccaaacatagccaagaagtacatcgaccagaagtttgta
cttgctctcctagacctatttgacagtgaggatcctcgagagcgagacttcctcaagacc
attttgcatcgcatctatggcaagtttttggggctccgggcttatatccgtaggcagatc
aaccacatcttctacaggttcatctatgagacggagcatcacaacgggattgctgagctc
ctggagatcctgggcagcatcatcaatggctttgccctgccccttaaagaagagcacaag
atgttcctcatccgtgtcctgcttccccttcacaaggtcaagtccctgagtgtctaccac
cctcagctggcatactgtgtggtacaattcctggagaaggagagcagtctgactgagccg
gtaattgtgggacttctcaagttttggcccaagacccacagccccaaggaggtgatgttc
ttgaatgagctggaggagattctggacgtcattgaaccttccgagttcagcaaagtgatg
gaacccctcttccgccagttggccaagtgcgtctctagcccccatttccaggtggcagag
cgtgctctctattactggaacaatgagtacatcatgagcctgataagtgacaatgctgcc
cgagtcctccccatcatgttccctgcactctacaggaactccaagagccactggaacaag
acaatccatgggctgatctacaatgccctgaagctgtttatggaaatgaatcagaagctg
tttgatgactgcacacaacaatacaaggcagagaagcagaagggccggttccgaatgaag
gaaagggaagagatgtggcaaaaaatcgaagagctggcccggcttaatccccagtatccc
atgttccgagcccctccaccactgccccctgtgtactcgatggagacagagacccctaca
gctgaggacatccagcttctgaagaggactgtggagactgaggctgttcagatgctaaaa
gacatcaagaaggagaaagtgctgctgcggaggaagtcggagctgccccaggacgtgtac
accatcaaggcactggaggcgcacaagcgggcggaagagttcctaactgccagccaggag
gctctctga

KEGG   Pongo abelii (Sumatran orangutan): 100436819
Entry
100436819         CDS       T01416                                 

Gene name
PPP2R2D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform isoform X2
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon04728  Dopaminergic synapse
pon05142  Chagas disease
pon05160  Hepatitis C
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100436819 (PPP2R2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100436819 (PPP2R2D)
   04071 Sphingolipid signaling pathway
    100436819 (PPP2R2D)
   04151 PI3K-Akt signaling pathway
    100436819 (PPP2R2D)
   04152 AMPK signaling pathway
    100436819 (PPP2R2D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100436819 (PPP2R2D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100436819 (PPP2R2D)
  09156 Nervous system
   04728 Dopaminergic synapse
    100436819 (PPP2R2D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100436819 (PPP2R2D)
   05165 Human papillomavirus infection
    100436819 (PPP2R2D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100436819 (PPP2R2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100436819 (PPP2R2D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100436819 (PPP2R2D)
   03036 Chromosome and associated proteins [BR:pon03036]
    100436819 (PPP2R2D)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100436819 (PPP2R2D)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100436819 (PPP2R2D)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100436819 (PPP2R2D)
SSDB
Other DBs
NCBI-GeneID: 100436819
NCBI-ProteinID: XP_009244218
LinkDB
Position
10
AA seq 288 aa
MDLMVEASPRRIFANAHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKP
ANMEELTEVITAAEFHPHQCNVFVYSSSKGTIRLCDMRSSALCDRHSKFFEEPEDPSSRS
FFSEIISSISDVKFSHSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYEN
DCIFDKFECCWNGSDSAIMTGSYNNFFRMFDRDTRRDVTLEASRESSKPRASLKPRKVCT
GGKRKKDEISVDSLDFNKKILHTAWHPADNVIAVAATNNLYIFQDKIN
NT seq 867 nt   +upstreamnt  +downstreamnt
atggatcttatggtagaagcgagtccacggcgaatttttgcaaatgctcacacatatcat
ataaattccatttcagtaaatagtgatcatgaaacatatctttctgcagatgacctgaga
attaatttatggcacttagaaatcacagatagaagctttaacatcgtggacatcaagcct
gctaacatggaggagctgaccgaagtgatcaccgcagccgaattccacccgcaccagtgc
aacgtgttcgtctacagcagtagcaaagggaccatccgactgtgtgacatgcgctcctcg
gccctgtgcgacagacactccaagttttttgaagagcctgaagatcccagcagtaggtcc
ttcttctcagaaataatttcatccatatccgatgtaaaattcagtcatagtgggcggtac
atgatgaccagagactacctgtcggtgaaggtgtgggacctcaatatggagagcaggccg
gtggagacccaccaggtccacgagtacctgcgcagcaagctctgctctctctatgagaat
gactgcatctttgacaagtttgagtgttgctggaacggttcggatagcgccatcatgact
gggtcctacaacaacttcttcagaatgtttgatagagacacgcggagggatgtgaccctg
gaggcctcgagagagagcagcaaaccgcgcgccagcctcaaaccccggaaggtgtgtaca
gggggtaagcggaagaaagacgagatcagtgtggacagtctggacttcaacaagaagatc
ctgcacacggcctggcaccccgcggacaatgtcattgccgtggctgccaccaataacttg
tacatattccaggacaaaatcaactag

KEGG   Pongo abelii (Sumatran orangutan): 100437405
Entry
100437405         CDS       T01416                                 

Gene name
PPP2CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04136  Autophagy - other
pon04140  Autophagy - animal
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04350  TGF-beta signaling pathway
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon05142  Chagas disease
pon05160  Hepatitis C
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100437405 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100437405 (PPP2CB)
   04390 Hippo signaling pathway
    100437405 (PPP2CB)
   04071 Sphingolipid signaling pathway
    100437405 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    100437405 (PPP2CB)
   04152 AMPK signaling pathway
    100437405 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100437405 (PPP2CB)
   04136 Autophagy - other
    100437405 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100437405 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100437405 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100437405 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    100437405 (PPP2CB)
   04730 Long-term depression
    100437405 (PPP2CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100437405 (PPP2CB)
   05165 Human papillomavirus infection
    100437405 (PPP2CB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100437405 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100437405 (PPP2CB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100437405 (PPP2CB)
   04131 Membrane trafficking [BR:pon04131]
    100437405 (PPP2CB)
   03036 Chromosome and associated proteins [BR:pon03036]
    100437405 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100437405 (PPP2CB)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100437405 (PPP2CB)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     100437405 (PPP2CB)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100437405 (PPP2CB)
Membrane trafficking [BR:pon04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100437405 (PPP2CB)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100437405 (PPP2CB)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100437405 (PPP2CB)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N
Other DBs
NCBI-GeneID: 100437405
NCBI-ProteinID: XP_002819017
Ensembl: ENSPPYG00000018491
UniProt: H2PPZ8
LinkDB
Position
8
AA seq 309 aa
MEDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggaagacaaggcgttcaccaaggagctggaccagtgggtcgagcagctgaacgagtgt
aagcagctgaacgagaaccaagtgcggacgctgtgcgagaaggcaaaggaaattttaaca
aaagaatcaaatgtgcaagaggttcgttgccctgttactgtctgtggagatgtgcatggt
caatttcatgatcttatggaactctttagaattggtggaaaatcaccagatacaaactac
ttattcatgggtgactatgtagacagaggatattattcagtggagactgtgactcttctt
gtagcattaaaggtgcgttatccagaacgcattacaatattgagaggaaatcacgaaagc
agacagattacccaagtatatggcttttatgatgaatgtctgcgaaagtatgggaatgcc
aacgtttggaaatattttacagatctctttgattatcttccacttacagctttagtagat
ggacagatattctgcctccatggtggcctgtctccatccatagacacactggatcatata
agagccctggatcgcttacaggaagttccacatgagggcccaatgtgtgatctgttatgg
tcagatccagatgatcgtggtggatggggtatttcaccacgtggtgctggctacacattt
ggacaagacatttctgaaacctttaaccatgccaatggtctcacactggtttctcgtgcc
caccagcttgtaatggagggatacaattggtgtcatgatcggaatgtggttaccattttc
agtgcacccaattactgttatcgttgtgggaaccaggctgctatcatggaattagatgac
actttaaaatattccttccttcaatttgacccagcgcctcgtcgtggcgagcctcatgtt
acacggcgcaccccagactacttcctataa

KEGG   Pongo abelii (Sumatran orangutan): 100437928
Entry
100437928         CDS       T01416                                 

Gene name
PPP2R1B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform isoform X1
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04350  TGF-beta signaling pathway
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon05142  Chagas disease
pon05160  Hepatitis C
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100437928 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100437928 (PPP2R1B)
   04390 Hippo signaling pathway
    100437928 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    100437928 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    100437928 (PPP2R1B)
   04152 AMPK signaling pathway
    100437928 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100437928 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100437928 (PPP2R1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100437928 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100437928 (PPP2R1B)
   04730 Long-term depression
    100437928 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100437928 (PPP2R1B)
   05165 Human papillomavirus infection
    100437928 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100437928 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100437928 (PPP2R1B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100437928 (PPP2R1B)
   03036 Chromosome and associated proteins [BR:pon03036]
    100437928 (PPP2R1B)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100437928 (PPP2R1B)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100437928 (PPP2R1B)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100437928 (PPP2R1B)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N M11L CLASP_N Cas_Csm6
Other DBs
NCBI-GeneID: 100437928
NCBI-ProteinID: XP_024110536
Ensembl: ENSPPYG00000003864
LinkDB
Position
11
AA seq 681 aa
MADASGLGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
SELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKA
VESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQ
QFRSLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIVPLFTNLASDEQDSVRLLAVEAC
VSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADKFSELQKAMGPKITLNDLIPAFQ
NLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTILGKENTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQ
RLRKLDFPVKDSGEPSVPRADKNHFPRPRMPGEDTGKIHSEKESSRAWLPRADARLRLVH
GEKSDVLTPILVGSLSENSMK
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggcggacgcatcggggctcgggaccggcccaggagcagcgggtggagatggagatgat
tcgctatacccaatcgcggttttaatcgacgagctccgcaatgaagacgtgcagctccga
ctcaacagtattaagaagttatcaacaattgccctagcacttggagtagaaaggacgcga
agtgaattgttgccatttcttacagatacaatttatgatgaagatgaggtactattagct
cttgctgagcagctgggaaatttcactggcctagtgggaggtcctgactttgcccactgt
ctgctgcctcctttggaaaatctggcaactgtggaagagactgttgttcgtgacaaggct
gtggagtccctgagacaaatatcccaggagcatactcctgttgctctggaagcttatttt
gtacctctggtgaaacgcctagcaagtggggattggttcacctctcgcacatctgcatgt
ggtttgttcagtgtttgctatcccagggcgtcaaatgctgttaaagcagaaatcagacag
caattccgttccttgtgctcagatgacacaccaatggtacgacgtgctgctgcttccaaa
ttgggtgaatttgcaaaagttttggaattagacaatgtgaaaagtgaaattgttccactg
ttcactaatctagcttcagatgaacaggattcagtgcgtcttcttgctgtggaagcttgt
gtcagtattgcccagttattgtctcaggatgaccttgagactttggtgatgcctacactt
cgacaagcagcagaagataaatcttggcgagttcgctatatggtggctgacaaattttca
gagctccagaaagccatgggtcctaaaatcaccctaaatgacctcatccccgcctttcag
aacctacttaaagactgtgaagctgaagtccgggcggctgctgcccacaaagtaaaagaa
cttggtgaaaacttgcccattgaagatagagagaccataattatgaatcaaattctgcct
tatataaaggaattagtatccgataccaatcaacatgtcaaatcggctctagcttctgta
attatgggattgtctactattttgggcaaagaaaataccattgaacatcttctacctctt
tttttagctcagttaaaggatgagtgtcctgaagttcgtttgaatatcatctccaatttg
gattgtgtaaatgaagtgattggaatccgtcagctctctcagtctctccttcctgccata
gtggagctggcagaagatgccaaatggagggtccgactggccatcattgagtatatgccg
ctgctggcaggccagctgggtgtggaattctttgatgaaaagctgaattctttatgtatg
gcttggcttgtggaccatgtatatgccatccgagaagctgccaccaacaacctcatgaaa
ctagttcagaagtttggtacagagtgggcccaaaataccattgttcccaaagtgttagta
atggcaaatgatcctaattacttgcatagaatgaccactttattctgcattaatgcactg
tctgaggcctgtggtcaggaaataaccactaagcaaatgctgcccatcgtattaaaaatg
gcaggagaccaagtagcaaatgttcgcttcaatgtggccaaatctctacaaaaaattgga
ccaattctagataccaatgctttacagggagaagttaagccagtactacagaagttaggt
caagatgaagacatggatgtcaaatactttgcacaggaagctataagtgtggtggcacaa
aggctgaggaagctagattttcctgtgaaggacagtggagaacccagtgtccctcgggct
gacaagaaccacttcccaagacccagaatgcctggagaggacacggggaagatacattca
gaaaaggagagcagcagggcttggctgcctcgtgcagatgccagactgcgtttagttcat
ggggaaaaatctgacgttctcacacccattctagtgggttcgcttagtgaaaattcaatg
aagtaa

KEGG   Pongo abelii (Sumatran orangutan): 100439998
Entry
100439998         CDS       T01416                                 

Gene name
PPP2R5B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04728  Dopaminergic synapse
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100439998 (PPP2R5B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100439998 (PPP2R5B)
   04151 PI3K-Akt signaling pathway
    100439998 (PPP2R5B)
   04152 AMPK signaling pathway
    100439998 (PPP2R5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100439998 (PPP2R5B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100439998 (PPP2R5B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100439998 (PPP2R5B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100439998 (PPP2R5B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100439998 (PPP2R5B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100439998 (PPP2R5B)
   03036 Chromosome and associated proteins [BR:pon03036]
    100439998 (PPP2R5B)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100439998 (PPP2R5B)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100439998 (PPP2R5B)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100439998 (PPP2R5B)
SSDB
Motif
Pfam: B56 FTCD_C
Other DBs
NCBI-GeneID: 100439998
NCBI-ProteinID: XP_024111534
LinkDB
Position
11
AA seq 497 aa
METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCNHIFL
RFIYEFEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY
CVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQFVKIQEPLFK
QVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL
IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKE
APLQRLTPQVAANGGQS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggagaccaagctgccccctgcaagcacccccactagcccctcctcccctgggctgtcg
cctgtgcccccaccagacaaggtggacggcttctcccgccgttccctccgcagagcccgg
ccccgccgctcccacagctcctctcagttccgctatcagagcaaccagcaggagctcaca
ccgctgcccctgctcaaagatgtgccggcttccgagctgcacgagctgctgagccggaag
ctggcccagtgtggggtgatgtttgacttcttggactgtgtggccgacctcaaggggaag
gaggtgaagcgggcagccctcaacgagctggtggagtgtgtggggagcacccggggtgtc
ctcatcgagcccgtctacccagacatcatccgcatgatctcagtgaatatcttccggact
ctgccgcccagtgagaaccctgaatttgaccctgaagaggatgagcccaaccttgagcct
tcgtggccacacctgcagctggtatatgagtttttcctgcgtttcttggagagcccagac
ttccagccctccgtggccaagagatatgtggatcaaaagtttgtcctgatgctcctggag
ctgtttgatagcgaggacccccgggagcgtgagtacctcaagaccatcctgcaccgggtc
tatggcaagttcctgggtctccgggcctacatccgcaaacagtgcaaccacatcttcctc
cggttcatctatgaattcgagcacttcaatggtgtggctgagctgctggagatcctagga
agcatcatcaatggctttgcgctgcccctgaagacggagcacaagcagttcctggttcgc
gtcctgatccccctgcactctgtcaagtcgctgtctgtcttccatgcccagctggcatac
tgtgtggtgcagttcctggagaaggatgccactctgacagagcacgtgatccgggggctg
ctcaaatactggccaaaaacctgcacccagaaggaggtgatgtttctgggggagatggaa
gagattcttgatgtcatcgagccctcccagtttgtgaagatccaggagcccctttttaag
caggtggctcgctgtgtttccagcccccatttccaggttgcagagcgggctctgtatttc
tggaacaatgagtatatcctaagcctcattgaggacaactgccacactgtgctgcctgct
gtgtttgggaccctctaccaagtctccaaggagcactggaaccaaaccatcgtatcactg
atctacaatgtgctcaagaccttcatggagatgaatgggaaactgtttgatgagctcaca
gcctcctacaagctggaaaagcagcaggagcagcagaaggcccaggagcgtcaggagtta
tggcaaggtctggaagagctgcggctacgccggctacaggggacccagggggccaaggag
gcccccctccagcggcttacaccccaggtggccgccaatggtggtcagagctag

KEGG   Pongo abelii (Sumatran orangutan): 100443527
Entry
100443527         CDS       T01416                                 

Gene name
PPP2R2A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon04728  Dopaminergic synapse
pon05142  Chagas disease
pon05160  Hepatitis C
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100443527 (PPP2R2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100443527 (PPP2R2A)
   04071 Sphingolipid signaling pathway
    100443527 (PPP2R2A)
   04151 PI3K-Akt signaling pathway
    100443527 (PPP2R2A)
   04152 AMPK signaling pathway
    100443527 (PPP2R2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100443527 (PPP2R2A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100443527 (PPP2R2A)
  09156 Nervous system
   04728 Dopaminergic synapse
    100443527 (PPP2R2A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100443527 (PPP2R2A)
   05165 Human papillomavirus infection
    100443527 (PPP2R2A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100443527 (PPP2R2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100443527 (PPP2R2A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100443527 (PPP2R2A)
   03036 Chromosome and associated proteins [BR:pon03036]
    100443527 (PPP2R2A)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100443527 (PPP2R2A)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100443527 (PPP2R2A)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100443527 (PPP2R2A)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 100443527
NCBI-ProteinID: XP_009241915
Ensembl: ENSPPYG00000018455
UniProt: H2PPV9 A0A663DBD5
LinkDB
Position
8
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcagtggtgtttttctcaggtgaaaggagca
gtagatgatgatgtagcagaagcagatataatttctacagtagaatttaatcattctgga
gaattactagcaacaggagataaaggtggtagagtcgtcatctttcaacaagagcaggag
aacaaaatccagtctcatagcagaggagaatataatgtttacagcaccttccagagccat
gaaccagagtttgactacttgaaaagtttagaaatagaagaaaagatcaacaaaattagg
tggttaccccagaaaaatgctgctcagtttttattgtctaccaatgataaaacaataaaa
ttatggaaaatcagtgaaagggacaaaagaccagaagggtataacttgaaagaggaagat
ggaaggtatagagatcctactacagttactacactacgagtgccagtctttaggcctatg
gatctaatggttgaggccagtccacgaagaatatttgccaatgctcatacatatcacatc
aactcaatttctattaatagtgattatgaaacatatttatctgcagatgatttgcggatt
aatctttggcatctggaaattacagacaggagttttaacattgtggatatcaagcctgcc
aatatggaagagctaacagaagtgattacagcggcagaatttcatccaaacagctgtaac
acatttgtatacagcagcagtaaaggaactattcggctatgtgacatgagggcatctgcc
ctctgtgatagacattctaaattgtttgaagaacctgaagatcccagtaacaggtcattt
ttttccgaaatcatctcctctatttcggatgtaaaattcagccatagtggtcgatatatg
atgactagagactatttgtcagtcaaaatttgggacttaaatatggaaaacaggcctgtg
gaaacataccaggtgcatgaatacctcagaagtaaactctgttcactgtatgaaaatgac
tgcatatttgacaaatttgaatgttgttggaatggatctgacagtgttgtcatgactgga
tcttacaataatttcttcagaatgtttgacagaaacacaaagcgagacataaccctagaa
gcatcgcgggaaaacaataagcctcgcacagttctgaagcctcgcaaagtctgtgcaagt
ggcaagcgaaagaaagatgaaataagtgttgacagcctagacttcaataagaaaatcctt
cacacagcctggcaccccaaggaaaatatcattgccgtagctactacaaacaatctgtat
atatttcaagacaaagtgaattag

KEGG   Pongo abelii (Sumatran orangutan): 100448353
Entry
100448353         CDS       T01416                                 

Gene name
PPP2R5A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04728  Dopaminergic synapse
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100448353 (PPP2R5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100448353 (PPP2R5A)
   04151 PI3K-Akt signaling pathway
    100448353 (PPP2R5A)
   04152 AMPK signaling pathway
    100448353 (PPP2R5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100448353 (PPP2R5A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100448353 (PPP2R5A)
  09156 Nervous system
   04728 Dopaminergic synapse
    100448353 (PPP2R5A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100448353 (PPP2R5A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100448353 (PPP2R5A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100448353 (PPP2R5A)
   03036 Chromosome and associated proteins [BR:pon03036]
    100448353 (PPP2R5A)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100448353 (PPP2R5A)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100448353 (PPP2R5A)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100448353 (PPP2R5A)
SSDB
Motif
Pfam: B56 Sec7_N
Other DBs
NCBI-GeneID: 100448353
NCBI-ProteinID: XP_002809528
Ensembl: ENSPPYG00000000237
UniProt: A0A663D935 H2N3S2
LinkDB
Position
1
AA seq 486 aa
MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLK
DATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY
SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIA
KRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET
EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL
EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV
SSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK
TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSIL
SNTSAE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcgtcgccgccggcgggggctgccagcgccgccatctcggcctcggagaaa
gtggacggcttcacccggaaatcggtccgcaaggcgcagaggcagaagcgctcccagggc
tcgtcgcagtttcgcagccagggcagccaggcagagctgcacccgctgccccagctcaaa
gatgccacttcaaatgaacaacaagagcttttctgtcagaagttgcagcagtgttgtata
ctgtttgatttcatggactctgtttcagacttgaagagcaaagaaattaaaagagcaaca
ctgaatgaactggttgagtatgtttcaactaatcgtggtgtaattgttgaatcagcgtat
tctgatatagtaaaaatgatcagtgctaacatcttccgtacacttcctccaagtgataat
ccagattttgatccagaagaggatgaacccacgcttgaggcctcttggcctcacatacag
ttggtatatgaattcttcttgagatttttggagagccctgatttccagcctagcattgca
aagcgatacattgatcagaaattcgtacaacagctcctggagctttttgatagtgaagat
cccagagaacgtgacttcctgaagactgttctgcaccgaatttatgggaaatttcttgga
ttaagagcattcatcagaaaacaaattaacaacattttcctcaggtttatatatgaaaca
gaacatttcaatggtgttgctgaacttcttgaaatattaggaagtattatcaatggcttt
gcattgccactgaaagcagaacataaacaatttctaatgaaggttcttattcctatgcat
actgcaaaaggattagctttgtttcatgctcagctagcatattgtgtcgtacagtttctg
gagaaagatacaacactaacagagccagtgatcagaggactgctgaaattttggccaaaa
acctgcagtcagaaagaggtgatgtttttaggagaaattgaagaaatcttagatgtcatt
gaaccaacacagttcaaaaaaattgaagagccactttttaagcagatatccaagtgtgta
tccagttctcattttcaggttgcagaaagggcattgtacttctggaataatgaatatatt
cttagtttgattgaggagaacattgataaaattctgccaattatgtttgccagtttgtac
aaaatttccaaagaacactggaatccgaccattgtagcactggtatacaatgtgctgaaa
actctaatggaaatgaatggcaagcttttcgatgaccttactagctcatacaaagctgaa
agacagagagagaaaaagaaggaattggaacgtgaagaattatggaaaaaattagaggag
ctaaagctaaagaaagctctagagaaacagaatagtgcttacaacatgcacagtattctc
agcaatacaagtgccgaataa

KEGG   Pongo abelii (Sumatran orangutan): 100450088
Entry
100450088         CDS       T01416                                 

Gene name
PPP2R3B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04728  Dopaminergic synapse
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100450088 (PPP2R3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100450088 (PPP2R3B)
   04151 PI3K-Akt signaling pathway
    100450088 (PPP2R3B)
   04152 AMPK signaling pathway
    100450088 (PPP2R3B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100450088 (PPP2R3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100450088 (PPP2R3B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100450088 (PPP2R3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100450088 (PPP2R3B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100450088 (PPP2R3B)
   03036 Chromosome and associated proteins [BR:pon03036]
    100450088 (PPP2R3B)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100450088 (PPP2R3B)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100450088 (PPP2R3B)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100450088 (PPP2R3B)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_6 EF-hand_1
Other DBs
NCBI-GeneID: 100450088
NCBI-ProteinID: XP_024097340
LinkDB
Position
X
AA seq 575 aa
MPPGKVLQPVLKMKVDELFLYWLSEASTQRMLQDCLRRIKAPGRDQPTAGDGELPGAWPA
ATLAAPRPSGLEPPGTPGPGPALPLGAASSPRNAPHARGTRRSAGTRVVQTRKEEPLSPA
TSQSIPTFYFPRGRPQDSVNVDAVISKIESTFAQFPHERATMDDMGLVAKACGCPLYWKG
PLFYGAGGERTGSVSVHKFVAMWRKILQNCHDDAAKFLHLLMSPGCNYLVQEDFVPFLQD
VVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGRITCAELRRSSFLQNVALLEE
EADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHAISTKMIDRIFSGAV
TRGRKVQKEGRISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQ
CRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLRDLKRCKLANVFFDTFFNIEKYLDH
EQKEQISLLRDGDSSGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSA
LRSPLAQRTFFEAPSPLGAMDLYEYACGDEDLEPL
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgcctcccggcaaggtactgcagccggtcctgaagatgaaggtggatgagctgttcctg
tactggctcagcgaggccagcacgcagcggatgctgcaggactgcctgcgccggatcaag
gcgcccgggcgggaccagccgaccgcgggggacggggagctgcccggggcctggccagca
gccacgctcgccgcccccaggcccagcgggctcgaacccccgggaacccccggtccgggc
cctgcgctgcccctgggcgccgcctccagccccaggaacgcgccccacgctcgaggcacc
cgtagatccgcagggacgagagtagttcagacgcggaaagaagagcctctgtccccagcc
acgagccaaagcattccgaccttctacttccccagaggacgcccgcaggactccgtcaat
gtggatgccgtcatcagcaagatcgagagcaccttcgcccagttcccccacgagagggcc
accatggacgacatgggcctggtggccaaggcctgcggctgccccctctactggaagggg
ccgctcttctatggcgccggcggggagcgcacgggctccgtgtccgtccacaagttcgtc
gccatgtggagaaaaatcctccagaactgccacgacgacgcggccaagttcctccatctg
ctcatgagccccggctgcaactacctggtgcaggaggactttgtccccttcttgcaggac
gtggtgaacacgcacccggggctgtcgttcctgaaggaggcgtccgagttccactcgcgc
tacatcaccacggtcatccagcggatcttctacgccgtgaaccggtcctggtccggcagg
atcacctgcgccgagctgcggaggagctccttcctgcagaacgtggcgctgctggaggag
gaggccgacatcaaccagctgaccgaattcttctcctacgagcacttctacgtcatctac
tgcaagttctgggagctggacacggaccacgacctgctcatcgacgcggacgacctggcg
cggcacaatgaccacgccatttctaccaagatgatcgacaggatcttctcaggagcagtc
acacgaggcagaaaagtgcagaaggaagggaggatcagctacgccgactttgtctggttt
ttgatctctgaggaagacaaaaaaacaccaaccagcatcgagtactggttccgctgcatg
gacctagatggggacggcgccctgtccatgttcgagctcgagtacttctacgaggagcag
tgccgaaggctggacagcatggccatcgaggccctgcccttccaggactgcctctgccag
atgctggacctggtcaagccgaggaccgaagggaagatcacgctgcgggacctgaagcgc
tgcaagctggccaacgtcttcttcgacaccttcttcaacatcgagaagtacctcgaccat
gagcagaaagagcagatctccctgctcagggacggtgacagcagcggccccgagctctcg
gactgggagaagtacgcggccgaggagtacgacatcctggtggctgaggagactgcggga
gagccctgggaggacgggttcgaggccgagctcagccctgtggagcagaagctgagtgcg
ctgcggtccccactggcccagaggaccttcttcgaggcgccctcgcccctgggcgccatg
gacctgtacgagtatgcgtgcggggacgaggacctggagccactgtga

KEGG   Pongo abelii (Sumatran orangutan): 100453295
Entry
100453295         CDS       T01416                                 

Gene name
PPP2R3A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04728  Dopaminergic synapse
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100453295 (PPP2R3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100453295 (PPP2R3A)
   04151 PI3K-Akt signaling pathway
    100453295 (PPP2R3A)
   04152 AMPK signaling pathway
    100453295 (PPP2R3A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100453295 (PPP2R3A)
  09156 Nervous system
   04728 Dopaminergic synapse
    100453295 (PPP2R3A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100453295 (PPP2R3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100453295 (PPP2R3A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100453295 (PPP2R3A)
   03036 Chromosome and associated proteins [BR:pon03036]
    100453295 (PPP2R3A)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100453295 (PPP2R3A)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100453295 (PPP2R3A)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100453295 (PPP2R3A)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 NPIP DUF4116
Other DBs
NCBI-GeneID: 100453295
NCBI-ProteinID: XP_024100783
LinkDB
Position
3
AA seq 1150 aa
MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGVDCIVVHHSVCADLLHIPV
SQFKDADLNSMFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTCNLKDIAGEAISFA
SGKIKEFSLEKLKNSNHAAYRKGRKVKSDSFNRRSVDLDLLCGHYNNDGNAPSFGLLRSS
SVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSCGTDIKMCLDILLKCS
EDLKKCTDIIKQCIKKKSGSSINEGSGNDTISSSETVYMNVMTRLASYLKKLPFEFMQSG
NNEALDLTELISNMPSLQLTPFSPVFGTEQPPKYEDVVQLSASDSGQFQTIELQDDKPNT
RKMDTVQSIPNNSTNSLYNLEVNDPRILKAVQVQSQSLTMNPLENVSSDNLMETLYIEEE
SDGKKALDKGQKTENGPSHELLKINEHRAEFPEHATHLKKCPAPMQNEIGKIFEKSFVHL
PKEDCKSKLSRFEEGDQRDFTNSSSQEEIDKLLMDLESFSQKMETSLREPLVKGKNSNSL
NSHSQLTGQTLVDLEPKSKVSSPIEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIED
FAQELVECKSSRGSLSQEKEMMQILQETLTTSSQTNLSVCRSPVGDKAKDTTSAVLIQQT
PEVIKIQNKPEKKPGTPLPPPAISPSSPRPLSPVPHVNNVVNAPLSINIPRFYFPEGLPD
TCSNHEQTVSRIETAFMDIEDQKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGFVTA
QSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPE
FHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHF
YVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYAD
FVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEHFYEEQCERMEAMGIEPLPFHD
LLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDG
PEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKGNKILSASLPEK
CGKLQSVDEE
NT seq 3453 nt   +upstreamnt  +downstreamnt
atggcagcaacttacagacttgtggtcagtactgtgaaccactacagcagcgtggtgata
gaccggcgttttgaacaagctatacattattgcactggaacctgccacaccttcacacat
ggagttgactgcattgtggtacaccatagtgtttgtgcagacctcttgcacatccctgtg
tctcagttcaaagatgcagatctgaactctatgtttctaccccatgaaaatgggctttct
tcggctgaaggagactatccccaacaggccttcacaggcatacccagggtcaagagagga
tctacatttcagaatacctgcaacttaaaggacattgcaggagaagcaatcagttttgcc
agtgggaaaataaaagaattttcccttgaaaaactcaaaaactctaaccatgcagcttat
agaaagggaaggaaagttaagtctgactcatttaataggaggtcagttgatttggacttg
ctttgtggccattataacaatgatgggaacgccccatcctttggtttactgcggagttcc
tcagttgaggaaaaaccgttgtctcataggaactcacttgatacgaacctgacttccatg
tttcttcaaaacttttctgaagaagacttggttactcagattttggaaaaacataaaata
gataatttttcttgtgggacagacataaagatgtgcttggacatcttattgaaatgctcc
gaggatttaaaaaaatgcacagacatcataaaacaatgcataaagaaaaaatcagggagt
agcatcaatgaaggaagtggtaatgatacaatttctagctctgaaactgtctatatgaat
gtaatgaccaggttagcatcctatctgaaaaagttaccatttgaattcatgcagtctggg
aataatgaggctctagatttaacagaactgatcagtaatatgcctagcttacaactgact
cccttctccccagtgtttggcactgaacaaccccctaaatatgaagatgttgtccagctc
tcagcttctgactctggacaatttcaaactattgaattgcaagatgacaagcctaatact
aggaagatggacactgtacaatccattccaaacaactccacaaattccttatataactta
gaggtaaatgatcctagaattctaaaagctgtccaagtccaatcacagtcattaaccatg
aaccctttagaaaatgtttcttctgacaacttaatggaaactctttatattgaagaagag
tcagatggaaagaaagcattagataaaggacaaaagacagagaatggacctagtcatgag
ttattaaagataaatgaacatagagcagaatttccagaacatgctactcatcttaaaaaa
tgccccgccccaatgcaaaatgaaattggtaagatatttgagaaatcatttgttcatcta
cctaaggaagactgtaaatcaaaactttctagatttgaagagggagaccagagagatttt
acaaattccagtagccaagaagagatagataaattgttaatggatttggaatctttttca
cagaagatggagacctctctaagagagccacttgtgaagggtaaaaactctaattcttta
aatagtcacagtcagttgactggtcagacccttgtagatcttgagcctaaatctaaagtc
tcttcacccatagaaaaagtctcaccttcctgtctaacaaggattattgaaaccaatgga
cacaaaatagaggaagaggatcgagccctcttactgcgaatcctggaaagcattgaagac
tttgctcaagaactagttgaatgcaaatcaagcagagggagcctatcacaagaaaaggaa
atgatgcaaattctacaggaaaccttgacaacttcctcccagaccaatttatcagtctgt
agaagtcctgttggtgataaagccaaagatactacttcagcagttttgattcagcagact
ccagaggtgatcaagattcaaaataaaccagaaaagaaacctggaacaccactcccacct
ccagccatctctccaagtagtccccgacctctctccccggttccccatgtgaataatgtt
gtgaatgcgccattgtccataaacattccacggttctactttcctgaaggactcccagat
acctgtagtaatcatgaacaaactgtaagcagaattgaaactgctttcatggatattgaa
gatcagaaagcagacatttatgaaatggggaaaattgcaaaggtctgtggctgtcctctc
tattggaaagcccccatgttcagggctgcagggggagagaagacaggatttgtgacagca
cagtcattcattgccatgtggagaaagttgctgaataaccatcatgatgatgcctctaaa
ttcatctgtcttctagcaaagcccaactgcagctctctagaacaggaggatttcatccct
ctacttcaggatgtggtggatacccaccctggtctcacgttcctgaaagatgctccagaa
ttccactcccgctacatcaccacggttattcagagaatattctacacagtcaacagatct
tggagtggaaaaattacttcgacagagataagaaaaagcaactttttgcaaaccctagca
cttttggaagaagaggaagatataaaccaaattacagattacttctcctatgaacatttc
tatgttatttattgtaaattctgggaactagatactgatcacgacctctacatcagccag
gccgatctgtctcgatacaatgaccaggcttcatcaagcaggattattgaaaggatattc
tctggggcagtaacaaggggaaaaacaatacagaaagagggaagaatgagctatgcagat
tttgtttggtttttgatctctgaagaagacaaaaggaatcctaccagcattgagtattgg
ttccgctgcatggatgtggatggagatggtgtactctccatgtatgagctggagcacttc
tatgaggagcagtgtgaacggatggaagccatgggaattgagcccttgccattccatgat
ttactgtgccagatgcttgacctagtgaagccagctgttgatggcaaaataactctaaga
gatctgaagaggtgcagaatggctcacatcttctatgacactttctttaatctggagaaa
tacttagaccatgaacagagagatccctttgcggtccagaaggatgttgagaacgatggg
cctgagccctcagactgggaccggtttgccgctgaggagtatgagactcttgttgcagag
gaatctgcccaagcacaattccaggaaggctttgaagattatgaaacagatgaacctgcc
tctccctctgaatttggaaacaaaggcaataaaatattaagtgcaagccttccagagaaa
tgtggaaagcttcaatcagtggatgaagaatag

KEGG   Pongo abelii (Sumatran orangutan): 100457751
Entry
100457751         CDS       T01416                                 

Gene name
PPP2R5E
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04728  Dopaminergic synapse
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100457751 (PPP2R5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100457751 (PPP2R5E)
   04151 PI3K-Akt signaling pathway
    100457751 (PPP2R5E)
   04152 AMPK signaling pathway
    100457751 (PPP2R5E)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100457751 (PPP2R5E)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100457751 (PPP2R5E)
  09156 Nervous system
   04728 Dopaminergic synapse
    100457751 (PPP2R5E)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100457751 (PPP2R5E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100457751 (PPP2R5E)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100457751 (PPP2R5E)
   03036 Chromosome and associated proteins [BR:pon03036]
    100457751 (PPP2R5E)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100457751 (PPP2R5E)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100457751 (PPP2R5E)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100457751 (PPP2R5E)
SSDB
Motif
Pfam: B56 Sec7_N SBF2
Other DBs
NCBI-GeneID: 100457751
NCBI-ProteinID: XP_024087444
Ensembl: ENSPPYG00000005889
LinkDB
Position
14
AA seq 467 aa
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQP
ELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVS
CNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKF
VLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAE
LLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTE
PVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVA
ERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNST
MFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcctcagcaccaactactcctccatcagtggataaagtagacggattttctcggaag
tccgtcagaaaagccagacagaagaggtcgcaaagttcctcacagtttaggtctcaaggc
aagcctattgagttaacacctctgccactgctaaaagacgttccatcctcagagcagcct
gaactgttcctaaagaaacttcagcagtgctgtgtcatttttgacttcatggacacgcta
tctgatcttaaaatgaaagaatacaagcgctccactcttaatgaactggtggactacatt
acaataagcagaggctgtttgacagagcagacttaccctgaagtagttagaatggtatct
tgcaatatattcagaactctccctcctagtgacagcaatgaatttgatccagaagaagat
gaacctacccttgaggcatcgtggccacacttacagcttgtatatgaatttttcatacga
tttttggaaagccaagaattccaacccagcattgccaaaaaatatatagatcagaaattt
gtattacagcttctggagctgtttgacagcgaagaccctcgggaacgggactacttaaaa
acagtcttacacagaatttatggcaagtttcttggtcttagagcatttatccgaaaacag
attaacaatatttttctaaggtttgtttatgaaacagaacacttcaatggtgtagctgaa
ctgctggaaatattaggaagtattatcaatggctttgctttacctcttaaggcagaacac
aaacagtttctggtgaaagtattgatccctttacacactgtcaggagcttatcactcttc
catgcacagctggcatattgtatagtacagtttctggagaaagatccttcactcacagaa
ccagttattagggggttaatgaaattttggcctaaaacatgtagtcaaaaagaggtcatg
ttccttggggaactggaagaaatattggatgttattgaaccttcacaatttgttaaaatc
caagaacctttgtttaaacaaatcgccaagtgtgtatctagcccccattttcaggtggca
gaaagagcactctattattggaataatgaatacatcatgagtttgatagaagaaaactct
aacgtcatccttcccatcatgttttccagcctttataggatttcaaaagaacattggaat
ccggctattgtggcattggtgtacaatgtgttgaaggcatttatggaaatgaacagcacc
atgtttgacgagctgacagccacatacaagtcagatcgtcagcgtgagaaaaagaaagaa
aaggagcgtgaagaattgtggaaaaaattggaggatctggagttaaagagaggtcttaga
cgtgatggaataattccaacttaa

KEGG   Pongo abelii (Sumatran orangutan): 100458345
Entry
100458345         CDS       T01416                                 

Gene name
PPP2R3C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04728  Dopaminergic synapse
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100458345 (PPP2R3C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100458345 (PPP2R3C)
   04151 PI3K-Akt signaling pathway
    100458345 (PPP2R3C)
   04152 AMPK signaling pathway
    100458345 (PPP2R3C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100458345 (PPP2R3C)
  09156 Nervous system
   04728 Dopaminergic synapse
    100458345 (PPP2R3C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100458345 (PPP2R3C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100458345 (PPP2R3C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100458345 (PPP2R3C)
   03036 Chromosome and associated proteins [BR:pon03036]
    100458345 (PPP2R3C)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100458345 (PPP2R3C)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100458345 (PPP2R3C)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100458345 (PPP2R3C)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_13 EF-hand_1 EF-hand_5 DUF61
Other DBs
NCBI-GeneID: 100458345
NCBI-ProteinID: XP_024087260
Ensembl: ENSPPYG00000005741
LinkDB
Position
14
AA seq 453 aa
MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
ENFLKVGEKAGAKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLY
DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDSENSAELDDT
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggactggaaagaagttcttcgtcggcgcctagcgacgcccaacacctgtccaaacaaa
aaaaaaagtgaacaagaattaaaagatgaagaaatggatttatttacaaaatattactcc
gaatggaaaggaggtagaaaaaacacaaatgaattctataagaccattccccggttttat
tataggctgcctgctgaagatgaagtcttactacagaaattaagagaggaatcaagagct
gtctttctacaaagaaaaagcagagaactgttagataatgaagaattacagaatttatgg
tttttgctggacaaacaccagacaccacctatgattggagaggaagcgatgatcaattac
gaaaactttttgaaggttggtgaaaaggctggagcaaagtgcaagcaatttttcacagca
aaagtctttgctaaactccttcatacagattcatatggaagaatttccatcatgcagttc
tttaattatgtcatgagaaaagtttggcttcatcaaacaagaataggactcagtttatat
gatgtcgctgggcaggggtaccttcgggaatctgatttagaaaactacatattggaactt
atccctacgttgccacaattagatggtctggaaaaatctttctactccttttatgtttgt
acagcagttaggaagttcttcttctttttagatcctttaagaacaggaaagataaaaatt
caagatattttagcatgcagcttcctagatgatttattggagctaagggatgaggaactg
tccaaggagagtcaagaaacaaattggttttctgctccttctgccctaagagtttatggc
cagtacttgaatcttgataaagatcacaatggcatgctcagtaaagaagaactctcacgc
tatggaacagctaccatgaccaatgtcttcttagaccgtgttttccaggagtgtctcact
tatgatggagaaatggactataagacctacttggactttgtccttgcattagaaaacaga
aaggaacctgcagctctacaatatattttcaaactgcttgatattgagaacaaaggatat
ctgaatgtcttttcacttaattatttttttagggccatacaagaactaatgaaaatccat
ggacaagatcctgtttcatttcaagatgtcaaggatgaaatctttgacatggtaaaacca
aaggatcctttgaaaatctctcttcaggatttaatcaacagtaatcaaggagacacagta
accaccattctaatcgatttgaatggcttctggacttatgagaacagagaagctcttgtt
gcaaatgacagtgaaaactctgcagaacttgatgatacatga

KEGG   Pongo abelii (Sumatran orangutan): 100461606
Entry
100461606         CDS       T01416                                 

Gene name
PPP2CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04136  Autophagy - other
pon04140  Autophagy - animal
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04350  TGF-beta signaling pathway
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon04728  Dopaminergic synapse
pon04730  Long-term depression
pon05142  Chagas disease
pon05160  Hepatitis C
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100461606 (PPP2CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100461606 (PPP2CA)
   04390 Hippo signaling pathway
    100461606 (PPP2CA)
   04071 Sphingolipid signaling pathway
    100461606 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    100461606 (PPP2CA)
   04152 AMPK signaling pathway
    100461606 (PPP2CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100461606 (PPP2CA)
   04136 Autophagy - other
    100461606 (PPP2CA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100461606 (PPP2CA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100461606 (PPP2CA)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100461606 (PPP2CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    100461606 (PPP2CA)
   04730 Long-term depression
    100461606 (PPP2CA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100461606 (PPP2CA)
   05165 Human papillomavirus infection
    100461606 (PPP2CA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100461606 (PPP2CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100461606 (PPP2CA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100461606 (PPP2CA)
   04131 Membrane trafficking [BR:pon04131]
    100461606 (PPP2CA)
   03036 Chromosome and associated proteins [BR:pon03036]
    100461606 (PPP2CA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100461606 (PPP2CA)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100461606 (PPP2CA)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     100461606 (PPP2CA)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100461606 (PPP2CA)
Membrane trafficking [BR:pon04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100461606 (PPP2CA)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100461606 (PPP2CA)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100461606 (PPP2CA)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 100461606
NCBI-ProteinID: XP_002815933
LinkDB
Position
5
AA seq 309 aa
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaaggtgttcaccaaggagcttgaccagtggatcgagcagctgaacgagtgc
aagcagctatccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaggaatccaacgtgcaagaggttcgatgtccagttactgtctgtggagatgtgcatggg
caatttcatgatctcatggaactgtttagaattggtggcaaatcaccagatacaaattac
ttgtttatgggagattatgttgacagaggatattattcagttgaaacagttacactgctt
gtagctcttaaggttcgctaccgtgaacgcatcaccattcttcgagggaatcatgagagc
agacagatcacacaagtttatggtttctatgatgaatgtttaagaaaatatggaaatgca
aatgtttggaaatattttacagatctttttgactatcttcctctcactgccttggtggat
gggcagatcttctgtctacatggtggtctctcgccatctatagatacactggatcatatc
agagcacttgatcgcctacaagaagttccccatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggtggttggggtatatctcctcgaggagctggttacaccttt
gggcaagatatttctgagacatttaatcatgccaatggcctcacgttggtgtctagagct
catcagctagtgatggagggatataactggtgccatgatcggaatgtagtaacgattttc
agtgctccaaactattgttatcgttgtggtaaccaagctgcaatcatggaacttgacgat
actctaaaatactctttcttgcagtttgacccagcacctcgtagaggcgagccacatgtt
actcgtcgtaccccagactacttcctgtaa

KEGG   Pongo abelii (Sumatran orangutan): 100462193
Entry
100462193         CDS       T01416                                 

Gene name
PPP2R2C
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, gamma
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04071  Sphingolipid signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04261  Adrenergic signaling in cardiomyocytes
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon04728  Dopaminergic synapse
pon05142  Chagas disease
pon05160  Hepatitis C
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100462193 (PPP2R2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100462193 (PPP2R2C)
   04071 Sphingolipid signaling pathway
    100462193 (PPP2R2C)
   04151 PI3K-Akt signaling pathway
    100462193 (PPP2R2C)
   04152 AMPK signaling pathway
    100462193 (PPP2R2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100462193 (PPP2R2C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100462193 (PPP2R2C)
  09156 Nervous system
   04728 Dopaminergic synapse
    100462193 (PPP2R2C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100462193 (PPP2R2C)
   05165 Human papillomavirus infection
    100462193 (PPP2R2C)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100462193 (PPP2R2C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100462193 (PPP2R2C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pon03019]
    100462193 (PPP2R2C)
   03036 Chromosome and associated proteins [BR:pon03036]
    100462193 (PPP2R2C)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100462193 (PPP2R2C)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100462193 (PPP2R2C)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100462193 (PPP2R2C)
SSDB
Other DBs
NCBI-GeneID: 100462193
NCBI-ProteinID: XP_024101891
LinkDB
Position
4
AA seq 447 aa
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDMH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggcgaggacacggacacgcggaaaattaaccacagcttcctgcgggaccacagctat
gtgactgaagctgacatcatctctaccgttgagttcaaccacacgggagagctgctggcc
acaggtgacaagggcggccgggtcgtcatcttccagcgggaaccagagagtaaaaatgcg
ccccacagccagggcgaatacgacgtctacagcactttccagagccacgagccggagttt
gactatctcaagagcctggagatagaggagaagatcaacaagatcaagtggctcccacag
cagaacgccgcccactcgctcctgtccaccaacgataaaactatcaaattatggaagatt
actgaacgagataaaaggcccgaaggatacaacctgaaggatgaagaggggaaacttaag
gacctgtccacggtgacgtcactgcaggtgccggtgctgaagcccatggatctgatggtg
gaggtgagccctcggaggatctttgccaatggccacacctaccacatcaactccatctcc
gtcaacagtgactgcgagacctacatgtcggcagatgacctgcgcatcaacctctggcac
ctggccatcaccgacaggagcttcaacatcgtggacatcaagccggccaacatggaggac
ctcacggaggtgatcacagcatctgagttccatccacaccactgcaacctcttcgtctac
agcagcagcaagggctccctgcggctctgtgacatgcgggcagctgccctgtgtgacaag
cattccaagctctttgaagagcccgaggaccccagtaaccgctccttcttctcggaaatc
atctcctccgtgtccgacgtgaagttcagccacagcggccgctacatgctcacccgggac
taccttacagtcaaggtctgggacctgaacatggaggcaagacccatagagacctaccag
gtccacgactaccttcggagcaagctctgttccctgtatgagaacgactgcattttcgac
aagtttgaatgtgcctggaacgggagcgacagcgtcatcatgaccggggcctacaacaac
ttcttccgcatgttcgatcggaacaccaagcgggacgtgaccctggaggcctcgagggaa
agcagcaagccccgggctgtgctcaagccacggcgcgtgtgcgtggggggcaagcgccgg
cgtgatgacatcagtgtggacagcttggacttcaccaagaagatcctgcacacagcctgg
cacccggctgagaacatcattgccatcgctgccaccaacaacctgtacatcttccaggac
aaggtaaactctgacatgcactag

DBGET integrated database retrieval system