Pongo abelii (Sumatran orangutan): 100173558 Help Entry 100173558         CDS       T01416                                  Gene name PFN2 Definition (RefSeq) profilin-2   KO K05759   profilin Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04015   Rap1 signaling pathway pon04810   Regulation of actin cytoskeleton pon05014   Amyotrophic lateral sclerosis pon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100173558 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100173558 (PFN2)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100173558 (PFN2)   09171 Infectious disease: bacterial    05132 Salmonella infection     100173558 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100173558 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pon04812]     100173558 (PFN2)    04147 Exosome [BR:pon04147]     100173558 (PFN2) Membrane trafficking [BR:pon04131]  Others   Actin-binding proteins    Others     100173558 (PFN2) Cytoskeleton proteins [BR:pon04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100173558 (PFN2) Exosome [BR:pon04147]  Exosomal proteins   Proteins found in most exosomes    100173558 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100173558 NCBI-ProteinID:  NP_001126567 Ensembl:  ENSPPYG00000014203 UniProt:  Q5R4E2 LinkDB All DBs Position 3 AA seq 140 aa AA seqDB search MAGWQSYVGNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtgggtaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat gtggctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

Pongo abelii (Sumatran orangutan): 100432952 Help Entry 100432952         CDS       T01416                                  Gene name PFN1 Definition (RefSeq) profilin-1   KO K05759   profilin Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04015   Rap1 signaling pathway pon04810   Regulation of actin cytoskeleton pon05014   Amyotrophic lateral sclerosis pon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100432952 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100432952 (PFN1)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100432952 (PFN1)   09171 Infectious disease: bacterial    05132 Salmonella infection     100432952 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100432952 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pon04812]     100432952 (PFN1)    04147 Exosome [BR:pon04147]     100432952 (PFN1) Membrane trafficking [BR:pon04131]  Others   Actin-binding proteins    Others     100432952 (PFN1) Cytoskeleton proteins [BR:pon04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100432952 (PFN1) Exosome [BR:pon04147]  Exosomal proteins   Proteins found in most exosomes    100432952 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100432952 NCBI-ProteinID:  XP_024090246 LinkDB All DBs Position 17 AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctacaaggactcgccctccgtctgggccgcggtccccggcaaaaccttc gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac gtgaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag gatggggaatttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgttcccagtac tga

Pongo abelii (Sumatran orangutan): 100433388 Help Entry 100433388         CDS       T01416                                  Gene name PFN3 Definition (RefSeq) profilin-3   KO K05759   profilin Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04015   Rap1 signaling pathway pon04810   Regulation of actin cytoskeleton pon05014   Amyotrophic lateral sclerosis pon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100433388 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100433388 (PFN3)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100433388 (PFN3)   09171 Infectious disease: bacterial    05132 Salmonella infection     100433388 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100433388 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pon04812]     100433388 (PFN3)    04147 Exosome [BR:pon04147]     100433388 (PFN3) Membrane trafficking [BR:pon04131]  Others   Actin-binding proteins    Others     100433388 (PFN3) Cytoskeleton proteins [BR:pon04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100433388 (PFN3) Exosome [BR:pon04147]  Exosomal proteins   Proteins found in most exosomes    100433388 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100433388 NCBI-ProteinID:  XP_002816318 Ensembl:  ENSPPYG00000016090 UniProt:  A0A6D2Y3X5 H2PHI2 LinkDB All DBs Position 5 AA seq 137 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLTVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI LNRKVHELIRGLRMQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaggtctacatcagtgcggtgctgcgggaccagcgcattgacgacgtg gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcgcaccttcctg caggcgggcctgaccgtggggggccgccgctgctgcgtcatccgcgaccacctgctggcc gagggcgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg ggccgtgcgccgcgcgcgctcctggtgctcatgggccgacgcggcgtccatgggggcatc ctcaacaggaaggtgcacgaactgatacgcgggctgcgcatgcagggcgcctag

Pongo abelii (Sumatran orangutan): 100437462 Help Entry 100437462         CDS       T01416                                  Gene name PFN4 Definition (RefSeq) profilin-4   KO K05759   profilin Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04015   Rap1 signaling pathway pon04810   Regulation of actin cytoskeleton pon05014   Amyotrophic lateral sclerosis pon05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100437462 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100437462 (PFN4)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100437462 (PFN4)   09171 Infectious disease: bacterial    05132 Salmonella infection     100437462 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pon04131]     100437462 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pon04812]     100437462 (PFN4)    04147 Exosome [BR:pon04147]     100437462 (PFN4) Membrane trafficking [BR:pon04131]  Others   Actin-binding proteins    Others     100437462 (PFN4) Cytoskeleton proteins [BR:pon04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100437462 (PFN4) Exosome [BR:pon04147]  Exosomal proteins   Proteins found in most exosomes    100437462 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100437462 NCBI-ProteinID:  XP_009235771 Ensembl:  ENSPPYG00000012601 UniProt:  A0A6D2XXY7 H2P6U0 LinkDB All DBs Position 2A AA seq 129 aa AA seqDB search MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVMPSDVQTLVNGFAKNPLQAR RGGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATESL GDYLRKKGS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt gcagccctcatcaaaatccaggagcggagcttgtgtgtagcatcaccaggtttcaatgta atgcccagtgatgtccaaacactggtgaatggatttgccaagaaccctttgcaagcccga agaggaggattgtatttcaagggaaaagattacagatgtgtccgggcagatgaatattct ctttatgccaaaaatgagaacactggtgtagttgtcgtgaagacccatctgtatcttctg gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagagcctg ggagactacctaagaaaaaaaggaagttaa

DBGET integrated database retrieval system