KEGG   Pongo abelii (Sumatran orangutan): 100173558
Entry
100173558         CDS       T01416                                 

Gene name
PFN2
Definition
(RefSeq) profilin-2
  KO
K05759  profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05014  Amyotrophic lateral sclerosis
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100173558 (PFN2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100173558 (PFN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100173558 (PFN2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100173558 (PFN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100173558 (PFN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100173558 (PFN2)
   04147 Exosome [BR:pon04147]
    100173558 (PFN2)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Others
    100173558 (PFN2)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100173558 (PFN2)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100173558 (PFN2)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 100173558
NCBI-ProteinID: NP_001126567
Ensembl: ENSPPYG00000014203
UniProt: Q5R4E2
LinkDB
Position
3
AA seq 140 aa
MAGWQSYVGNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccggttggcagagctacgtgggtaacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt
cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc
gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat
gtggctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

KEGG   Pongo abelii (Sumatran orangutan): 100432952
Entry
100432952         CDS       T01416                                 

Gene name
PFN1
Definition
(RefSeq) profilin-1
  KO
K05759  profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05014  Amyotrophic lateral sclerosis
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100432952 (PFN1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100432952 (PFN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100432952 (PFN1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100432952 (PFN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100432952 (PFN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100432952 (PFN1)
   04147 Exosome [BR:pon04147]
    100432952 (PFN1)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Others
    100432952 (PFN1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100432952 (PFN1)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100432952 (PFN1)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 100432952
NCBI-ProteinID: XP_024090246
LinkDB
Position
17
AA seq 140 aa
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY
VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggctacaaggactcgccctccgtctgggccgcggtccccggcaaaaccttc
gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac
gtgaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag
gatggggaatttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat
gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgttcccagtac
tga

KEGG   Pongo abelii (Sumatran orangutan): 100433388
Entry
100433388         CDS       T01416                                 

Gene name
PFN3
Definition
(RefSeq) profilin-3
  KO
K05759  profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05014  Amyotrophic lateral sclerosis
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100433388 (PFN3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100433388 (PFN3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100433388 (PFN3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100433388 (PFN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100433388 (PFN3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100433388 (PFN3)
   04147 Exosome [BR:pon04147]
    100433388 (PFN3)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Others
    100433388 (PFN3)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100433388 (PFN3)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100433388 (PFN3)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 100433388
NCBI-ProteinID: XP_002816318
Ensembl: ENSPPYG00000016090
UniProt: A0A6D2Y3X5 H2PHI2
LinkDB
Position
5
AA seq 137 aa
MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRRTFL
QAGLTVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI
LNRKVHELIRGLRMQGA
NT seq 414 nt   +upstreamnt  +downstreamnt
atgggcgactggaaggtctacatcagtgcggtgctgcgggaccagcgcattgacgacgtg
gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg
gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcgcaccttcctg
caggcgggcctgaccgtggggggccgccgctgctgcgtcatccgcgaccacctgctggcc
gagggcgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg
ggccgtgcgccgcgcgcgctcctggtgctcatgggccgacgcggcgtccatgggggcatc
ctcaacaggaaggtgcacgaactgatacgcgggctgcgcatgcagggcgcctag

KEGG   Pongo abelii (Sumatran orangutan): 100437462
Entry
100437462         CDS       T01416                                 

Gene name
PFN4
Definition
(RefSeq) profilin-4
  KO
K05759  profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05014  Amyotrophic lateral sclerosis
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100437462 (PFN4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100437462 (PFN4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100437462 (PFN4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100437462 (PFN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100437462 (PFN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100437462 (PFN4)
   04147 Exosome [BR:pon04147]
    100437462 (PFN4)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Others
    100437462 (PFN4)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100437462 (PFN4)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100437462 (PFN4)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 100437462
NCBI-ProteinID: XP_009235771
Ensembl: ENSPPYG00000012601
UniProt: A0A6D2XXY7 H2P6U0
LinkDB
Position
2A
AA seq 129 aa
MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVMPSDVQTLVNGFAKNPLQAR
RGGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATESL
GDYLRKKGS
NT seq 390 nt   +upstreamnt  +downstreamnt
atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt
gcagccctcatcaaaatccaggagcggagcttgtgtgtagcatcaccaggtttcaatgta
atgcccagtgatgtccaaacactggtgaatggatttgccaagaaccctttgcaagcccga
agaggaggattgtatttcaagggaaaagattacagatgtgtccgggcagatgaatattct
ctttatgccaaaaatgagaacactggtgtagttgtcgtgaagacccatctgtatcttctg
gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagagcctg
ggagactacctaagaaaaaaaggaagttaa

DBGET integrated database retrieval system