KEGG   Pongo abelii (Sumatran orangutan): 100173935
Entry
100173935         CDS       T01416                                 

Gene name
HTR2A
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04540  Gap junction
pon04726  Serotonergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100173935 (HTR2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100173935 (HTR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100173935 (HTR2A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100173935 (HTR2A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100173935 (HTR2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100173935 (HTR2A)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100173935 (HTR2A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 100173935
NCBI-ProteinID: NP_001126918
LinkDB
Position
13
AA seq 471 aa
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFSLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEDASKDNSDGVNEKVSCV
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggatattctttgtgaagaaaatacttctttgagctcaactacgaactccctaatgcaa
ttaaatgatgacaccaggctctacagtaatgactttaactccggagaagctaacacttct
gatgcatttaactggacagtcgactctgaaaatcgaaccaacctttcctgtgaagggtgc
ctctcaccatcgtgtctctctttacttcatctccaggaaaaaaactggtctgctttattg
acggccgtagtgattattctaactattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctctgccgagcaagctttgcgcagtctggatttacctggacgtgctcttctccacg
gcctccatcatgcacctctgcgccatctcgctggaccgctacgtcgccatccagaatccc
atccaccacagccgcttcaactccagaactaaggcatttctgaaaatcattgctgtttgg
accatatcagtaggtatatccatgccaataccagtctttgggctacaggacgattcgaag
gtctttaaggaggggagttgcttactcgccgatgataactttgtcctgatcggctctttt
gtgtcatttttcattcccttaaccatcatggtgatcacctactttctaactatcaagtca
ctccagaaagaagctactttgtgtgtaagtgatcttggcacacgggccaaattagcttct
ttcagcttcctccctcagagttctttgtcttcagaaaagctcttccagcggtcaatccat
agggagccagggtcctacacaggcaggaggactatgcagtccatcagcaatgagcaaaag
gcatgcaaggtgctgggcattgtcttctccctgtttgtggtgatgtggtgccctttcttc
atcacgaacatcatggctgtcatctgcaaagagtcctgcaatgaggatgtcattggggcc
ctgctcaatgtgtttgtttggatcggttatctctcttcagcagtcaacccactagtctac
acactgttcaacaagacctataggtcagccttttcacggtatattcagtgtcagtacaag
gaaaacaaaaaaccattgcagttaattttagtgaacactataccggctttggcctacaag
tctagccaacttcaaatgggacaaaaaaagaattcaaagcaagatgccaagacaacggat
aatgactgctcaatggttgctctaggaaagcagcattctgaagatgcttctaaagacaat
agcgacggagtgaatgaaaaggtgagctgtgtgtga

KEGG   Pongo abelii (Sumatran orangutan): 100440561
Entry
100440561         CDS       T01416                                 

Gene name
HTR2C
Definition
(RefSeq) 5-hydroxytryptamine receptor 2C isoform X2
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04540  Gap junction
pon04726  Serotonergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100440561 (HTR2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100440561 (HTR2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100440561 (HTR2C)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100440561 (HTR2C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100440561 (HTR2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100440561 (HTR2C)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100440561 (HTR2C)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 100440561
NCBI-ProteinID: XP_003779753
UniProt: A0A2J8VAD1
LinkDB
Position
X
AA seq 248 aa
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRCISSYPCDWTEGRRQGVREQHDVRAQRP
KFRSYWVLRSFLHTADDYGDYVLPDDLRSAPTSFDVTARPHRGTAWTKSGFPEVLQEEYG
RGRELCKP
NT seq 747 nt   +upstreamnt  +downstreamnt
atggtgaacctgaggaacgcggtgcattcattccttgtgcacctaattggcctattggtt
tggcaatgcgatatttctgtgagcccagtagcagctatagtaactgacattttcaatacc
tccgatggtggacgcttcaaattcccagacggggtacaaaactggccagcactttcaatc
gtcgtcataataatcatgacaataggtggcaacatccttgtgatcatggcagtaagcatg
gaaaagaaactgcacaatgccaccaattacttcttaatgtccctagccattgctgatatg
ctagtgggactacttgtcatgcccctgtctctcctggcaatcctttatgattatgtctgg
ccactacctagatatttgtgccccgtctggatttctttagatgttttattttcaacagcg
tccatcatgcacctctgcgctatatcgctggatcggtgtatcagttcctatccctgtgat
tggactgagggacgaagacaaggtgttcgtgaacaacacgacgtgcgtgctcaacgaccc
aaatttcgttcttattgggtccttcgtagctttcttcataccgctgacgattatggtgat
tacgtattgcctgacgatctacgttctgcgccgacaagctttgatgttactgcacggcca
caccgaggaaccgcctggactaagtctggatttcctgaagtgctgcaagaggaatacggc
cgaggaagagaactctgcaaaccctaa

KEGG   Pongo abelii (Sumatran orangutan): 100461323
Entry
100461323         CDS       T01416                                 

Gene name
HTR2B
Definition
(RefSeq) 5-hydroxytryptamine receptor 2B isoform X1
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04540  Gap junction
pon04726  Serotonergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100461323 (HTR2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100461323 (HTR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100461323 (HTR2B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100461323 (HTR2B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100461323 (HTR2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100461323 (HTR2B)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100461323 (HTR2B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100461323
NCBI-ProteinID: XP_024098877
LinkDB
Position
2B
AA seq 481 aa
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGNFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggctctctcttacagagtgtctgaacttcaaagcacaattcctgagcacattttgcag
agcacctttgttcacgttatctcttctaactggtctggattacagacagaatcaatacca
gaggaaatgaaacagattgttgaggaacagggaaataaactgcactgggcagctcttctg
atactcatggtgataatacccacaattggtggaaatacccttgttattctggctgtctcg
ctggagaaaaagctgcagtatgctactaattactttctcatgtccttggcggtggctgat
ttgctggttggattgtttgtgatgccaattgccctcttgacaataatgtttgaggctatg
tggcccctcccacttgttctatgtcctgcctggttatttcttgacgttctcttttcaacc
gcatccatcatgcatctctgtgcgatttcagtggatcgttacatagccatcaaaaagcca
atccaggccaatcaatataactcacgggctacggcattcatcaagattacagtggtgtgg
ttaatttcaataggcattgccattccagtccctattaaagggatagagactgatgtggac
aacccaaacaatatcacttgtgtgctgacaaaggaacgttttggcaatttcatgctcttt
ggctcactggctgccttcttcacacctcttgcaattatgattgtcacctactttctcact
atccacgctttacagaagaaggcttacttggtcaaaaacaagccacctcaacgcctaaca
tggttgactgtgtctacagttttccaaagggatgaaacaccttgctcgtcaccggaaaag
gtggcaatgctggatggttctcgaaaggacaaggctctgcccaactcaggtgatgaaaca
cttatgcgaagaacatccacaattgggaaaaagtcagtgcagaccatttccaacgaacag
agagcctcaaaggtcctagggattgtgtttttcctctttttgcttatgtggtgtcccttc
tttattacaaatataactttagttttatgtgattcctgtaaccaaactactctccaaatg
ctcctggagatatttgtgtggataggctatgtttcctcaggagtgaatcctttggtctac
accctcttcaataagacatttcgggatgcatttggccgatatatcacctgcaattaccgg
gccacaaagtcagtaaaaactctcagaaaacgctccagtaagatctacttccggaatcca
atggcagagaactctaagtttttcaagaaacatggaattcgaaatgggattaatcctgcc
atgtaccagagtccaatgaggctccgaagttcaaccattcagtcttcatcaatcattcta
ctagatacacttctcctcactgaaaatgaaggtgacaaaactgaagagcaagttagttat
gtatag

DBGET integrated database retrieval system