KEGG   Pongo abelii (Sumatran orangutan): 100174061Help
Entry
100174061         CDS       T01416                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
pon04146  Peroxisome
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100174061 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100174061 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100174061 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100174061 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    100174061 (SOD2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100174061 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100174061
NCBI-ProteinID: NP_001127035
Ensembl: ENSPPYG00000017143
UniProt: A0A2J8XB16
LinkDB All DBs
Position
6
AA seq 222 aa AA seqDB search
MLSRGVCGTSRQLAPALGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccggggagtgtgcggcaccagcaggcagctggcgccggctttgggatatctg
ggctccaggcagaagcacagcctccccgacctgccctacgactacggcgccctggagcct
cacataaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctgaacgtcaccgaggagaagtaccaggaggcgttggccaagggagatgttacagcc
cagatagctcttcagcctgccctgaagttcaatggtggtggtcatatcaatcatagcatt
ttctggacaaacctcagccctaacggtggtggagaacccaaaggggagttgctggaagcc
atcaaacgtgactttggttcctttgacaagtttaaggagaagctgacggctgcatctgtt
ggtgtccaaggctcaggttggggttggcttggtttcaataaggaacggggacacttacaa
attgctgcttgtccgaatcaggatccactgcaaggaacgacaggccttattccactgctg
gggattgatgtgtgggagcacgcttactaccttcagtataaaaatgtcaggcctgattat
ctgaaagctatttggaatgtaatcaactgggagaatgtaacagaaagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system