KEGG   Pongo abelii (Sumatran orangutan): 100174076
Entry
100174076         CDS       T01416                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha-2
  KO
K05691  catenin alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04390  Hippo signaling pathway
pon04520  Adherens junction
pon04670  Leukocyte transendothelial migration
pon05100  Bacterial invasion of epithelial cells
pon05200  Pathways in cancer
pon05213  Endometrial cancer
pon05226  Gastric cancer
pon05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100174076 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100174076 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100174076 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174076 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100174076 (CTNNA2)
   05213 Endometrial cancer
    100174076 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100174076 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100174076 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100174076 (CTNNA2)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100174076 (CTNNA2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 100174076
NCBI-ProteinID: NP_001127048
Ensembl: ENSPPYG00000012245
UniProt: Q5R416 A0A2J8TE81
LinkDB
Position
2A
AA seq 905 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASYVAST
KYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFK
AMDSF
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgacttcggcaacttcacctatcattctgaaatgggaccccaaaagtttggaaatccgg
acgctaacagtggaaaggctgttggagccacttgttacacaggtgactacacttgtcaac
acaagcaacaaaggcccatctggtaaaaagaaagggaggtcaaagaaagcccatgtacta
gctgcctctgtagagcaagccactcagaacttcctggaaaagggtgaacagatcgctaag
gagagtcaagatctcaaagaagagttggtggctgctgtagaggatgtgcgcaaacaaggt
gagacaatgcggatcgcctcctccgagtttgctgatgacccttgctcgtcggtaaagcgc
ggcaccatggtgcgggcggcaagggctttgctctccgcagtgacacgcttactcatcctg
gcggacatggcagatgtcatgagacttttatcccatctgaaaattgtggaagaggccctg
gaagctgtcaaaaatgctacaaatgagcaagaccttgcaaaccgttttaaagagtttgga
aaagagatggtgaaacttaactatgtagcagcaagaagacaacaggagctgaaggatcct
cactgtcgggatgagatggcagccgcccgaggggctctgaagaagaatgccacaatgctg
tacacggcctctcaagcatttctccgccacccagatgtcgccgctacgagagccaaccga
gattacgtattcaaacaagtccaggaggccatcgccggcatctccaatgctgctcaagct
acctcgcccactgacgaagccaaaggccacacgggcatcggcgagctggctgcggcgctt
aatgagtttgacaataagattatcctggaccccatgacgttcagcgaggccaggttccgg
ccgtccctggaggagaggctggagagcatcatcagcggcgcagcgctgatggccgactcc
tcctgcacgcgagacgaccggcgcgagaggatcgtggcggagtgcaacgccgtgcggcag
gcgctccaggacctgctcagcgagtacatgaataatactggaaggaaagaaaaaggagat
cctctcaacattgcgattgataagatgactaagaaaacaagagatctaaggagacagctt
cggaaagcagtgatggatcacatatctgattctttcttggaaaccaatgttcctttgcta
gttctcattgaggctgcaaagagcggaaatgaaaaggaagtgaaagaatatgctcaagtt
ttccgtgagcatgccaacaaactggtagaggttgccaatttggcctgttccatctccaac
aatgaagaaggggtgaaattagttcggatggcagccacccagattgacagcctgtgtccc
caggtcatcaatgccgctctgacactggctgcccggccacagagcaaagttgctcaggat
aacatggatgtcttcaaagaccagtgggagaagcaggtccgagtgttgacagaggccgtg
gatgacatcacctcagtggatgacttcctctctgtctcagaaaatcacatcttggaggat
gtgaacaagtgtgtgatagccctccaagagggtgatgtggacactctggaccggactgca
ggggccatcaggggccgggcagctcgagtcatacatatcatcaatgctgagatggagaac
tatgaagctggagtttatactgagaaggtgctggaagctacaaaattgctttctgaaaca
gtgatgccacgctttgctgaacaagtagaggttgccattgaagccctgagtgccaacgtt
cctcaaccatttgaggagaatgagttcatcgatgcctctcgcctggtgtatgatggcgtt
cgggacatcagaaaggctgtgctgatgatcaggaccccagaagaactagaggatgattca
gactttgagcaggaagattatgatgtgcgtagcaggacaagtgttcagactgaggatgac
cagctcattgcagggcagagcgcacgggccatcatggcgcaattaccgcaggaggagaag
gcaaaaatagctgagcaggtggagatattccatcaagagaaaagcaagctggatgcagaa
gtggccaaatgggacgacagcggcaatgatatcattgtactggccaagcagatgtgtatg
atcatgatggaaatgacagacttcacaagaggcaaaggcccattgaaaaatacatctgat
gtcattaatgctgccaagaaaattgccgaagcaggttctcgaatggacaaattagctcgc
gctgtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaa
cgaattgccttgtattgccatcagcttaatatctgcagcaaggtgaaggcagaagtgcag
aatctgggaggagagctcattgtgtcagggctggacagtgccacatcgcttatccaggca
gctaaaaacctgatgaatgctgttgtcctcacggtgaaagcatcctatgtggcctcaacc
aaataccagaaggtctatgggacagcagctgtcaactcacctgttgtgtcttggaagatg
aaggctccagagaagaagccccttgtgaagagagaaaagcctgaagaattccagacacga
gttcgacgaggttctcagaagaaacacatttcgcctgtacaggctttaagtgaattcaaa
gcaatggattccttctag

KEGG   Pongo abelii (Sumatran orangutan): 100453792
Entry
100453792         CDS       T01416                                 

Gene name
CTNNA1
Definition
(RefSeq) catenin alpha-1 isoform X1
  KO
K05691  catenin alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04390  Hippo signaling pathway
pon04520  Adherens junction
pon04670  Leukocyte transendothelial migration
pon05100  Bacterial invasion of epithelial cells
pon05200  Pathways in cancer
pon05213  Endometrial cancer
pon05226  Gastric cancer
pon05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100453792 (CTNNA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100453792 (CTNNA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100453792 (CTNNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100453792 (CTNNA1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100453792 (CTNNA1)
   05213 Endometrial cancer
    100453792 (CTNNA1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100453792 (CTNNA1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100453792 (CTNNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100453792 (CTNNA1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100453792 (CTNNA1)
SSDB
Motif
Pfam: Vinculin Peptidase_C5
Other DBs
NCBI-GeneID: 100453792
NCBI-ProteinID: XP_002815983
Ensembl: ENSPPYG00000015832
UniProt: H2PGP5 A0A6D2VX13
LinkDB
Position
5
AA seq 905 aa
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKTAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGELAYALNNFDKQIIVDPLSFSEERF
RPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKERS
DALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQ
VFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQ
ENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRT
AGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSD
PAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAST
KYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFK
AMDSI
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgactgctgtccacgctggcaacataaacttcaagtgggatcccaaaagtctagagatc
aggactctggcagttgagagactgttggagcctcttgttacacaggttacaaccctggta
aacaccaatagtaaggggccctctaataagaagagaggtcgttctaagaaggcccatgtt
ttggctgcatctgttgaacaagcaactgagaatttcttggagaagggggataaaattgcg
aaggagagccagtttctcaaggaggagcttgtggctgctgtagaagatgttcgaaaacaa
ggtgatttgatgaagactgctgcgggagagttcgcagatgatccctgctcttctgtgaag
cgaggcaacatggttcgggcagctcgagctttgctctctgctgttacccggttgctgatt
ttggctgacatggcagatgtctacaaattacttgttcaactgaaagttgtggaagatggt
atcttgaagttgaggaatgctggcaatgaacaagacttaggaatccagtataaagcccta
aaacctgaagtggataagctgaacattatggcagccaaaagacaacaggaattgaaagat
gttggccatcgtgatcagatggctgcagctagaggaatcctgcagaagaacgttccgatc
ctgtatactgcatcccaggcatgcctacagcaccctgatgtcgcagcctataaggccaac
agggacctgatatacaagcagctgcagcaggcggtcacaggcatttccaatgcagcccag
gccaccgcctcagatgatgcctcccagcaccagggtggaggaggagaattggcatatgca
ctcaataactttgacaaacaaatcattgtggaccccttgagcttcagcgaggagcgcttt
aggccttccctggaggagcgcctggaaagcatcattagtggggctgccttgatggccgac
tcgtcctgcacgcgtgatgaccgtcgtgagcgaattgtggcagagtgtaatgctgtccgc
caggccctgcaggacctgctttcggagtacatgggcaatgctggacgtaaagaaagaagt
gatgcactcaattctgcaatagataaaatgaccaagaagaccagggacttgcgtagacag
ctccgcaaagctgtcatggaccacgtttcagattctttcctggaaacaaatgttccactt
ttggtgttgattgaagctgcaaagaatggaaatgagaaagaagttaaggagtatgcccaa
gttttccgtgaacatgccaacaaattgattgaggttgccaacttggcctgttccatctca
aataatgaagaaggtgtaaagcttgttcgaatgtctgcaagccagttagaagccctctgt
cctcaggttattaatgctgcattggctttagcagcaaaaccacagagtaaactggcccaa
gagaacatggatctttttaaagaacaatgggaaaaacaagtccgtgtcctcacagatgct
gtcgatgatattacatccattgatgacttcttggctgtctcagagaatcacattttggaa
gatgtgaacaaatgtgtcattgctctccaagagaaggatgtggatggcctggaccgcaca
gctggtgcaattcgaggccgggcagcccgggtcattcatgtagtcacctcagagatggac
aactatgagccaggagtctacacagagaaggttctggaagccactaagctgctctccaac
acagtcatgccacgttttactgagcaagtagaagcagctgtggaagccctcagctcggac
cctgcccagcccatggatgagaatgagtttatcgatgcctcccgcctggtatatgatggc
atccgggacatcaggaaagcagtgctgatgataaggacccctgaggagttggatgactct
gactttgagacagaagatttcgatgtcagaagcaggacgagcgtccagacagaagacgat
cagctgatagctggccagagtgcccgggcgatcatggctcagcttccccaggagcaaaaa
gcgaagattgcggaacaggtggccagcttccaggaagaaaagagcaagctggatgctgaa
gtgtccaaatgggacgacagtggcaatgacatcattgtgctggccaagcagatgtgcatg
attatgatggagatgactgactttacccgaggtaaaggaccactcaaaaatacatcagat
gtcatcagtgctgccaagaaaattgctgaggcaggatccaggatggacaagcttggccgt
accatcgcagaccattgccctgactcggcttgcaagcaggacctgctggcctacctgcag
cgcatcgccctctactgccaccagctcaacatctgcagcaaggtcaaggccgaggtgcag
aatctcggcggggagctcgttgtctctggggtggacagcgccatgtccctgatccaggca
gccaagaacttgatgaatgctgtggtgcagacagtgaaagcatcctacgtcgcctctacc
aaataccaaaagtcacagggtatggcttccctcaaccttcctgctgtgtcatggaagatg
aaggcaccagagaaaaagcccttggtgaagagagagaaacaggatgagacacagaccaag
attaaacgggcatctcagaagaagcacgtgaacccggtgcaggccctcagcgagttcaaa
gctatggacagcatctaa

DBGET integrated database retrieval system