KEGG   Pongo abelii (Sumatran orangutan): 100174148
Entry
100174148         CDS       T01416                                 

Gene name
WASF1
Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 1
  KO
K05753  WAS protein family, member 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04520  Adherens junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100174148 (WASF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100174148 (WASF1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100174148 (WASF1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100174148 (WASF1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100174148 (WASF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100174148 (WASF1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     100174148 (WASF1)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 100174148
NCBI-ProteinID: NP_001127108
Ensembl: ENSPPYG00000016918
UniProt: Q5NVG8
LinkDB
Position
6
AA seq 559 aa
MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAH
SFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIP
LQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQK
QKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQ
TYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGEAKPIPTCISSA
TGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPA
TALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEV
QGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIP
ASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIA
VEYSDSEDDSEFDEVDWLE
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgccactagtgaaaagaaacatcgatcctaggcacttgtgccacacagcactgcctaga
ggcattaagaatgaactggaatgtgtaaccaatatttccttggcaaatataattagacaa
ctaagtagcctaagtaaatatgctgaagatatatttggagaattattcaatgaagcacat
agtttttccttcagagtcaactcattgcaagaacgtgtggaccgtttatctgttagtgtt
acacagcttgatccaaaggaagaagaattgtctttgcaagatataacaatgaggaaagct
ttccgaagttctacaattcaagaccagcagcttttcgatcgcaagactttgcctattcca
ttacaggagacgtacgatgtttgtgaacagcctccacctctcaatatactcactccttat
agagatgatggtaaagaaggtctgaagttttataccaatccttcatatttctttgatcta
tggaaagaaaaaatgttgcaagatacagaggataagaggaaggaaaagaggaagcagaag
cagaaaaatctagatcgtcctcatgaaccagaaaaagtgccaagagcacctcatgacagg
cggcgagaatggcagaagctggcccaaggtccagagctggctgaagatgatgctaatctc
ttacataagcatattgaagttgctaatggcccagcctctcattttgaaacaagacctcag
acatacgtggatcatatggatggatcttactcactttctgccttgccatttagtcagatg
agtgagcttctgactagagctgaggaaagggtattagtcagaccacatgaaccacctccg
cctccaccaatgcatggagcaggagaggcaaaaccgatacccacctgtatcagttctgct
acaggtttgatagaaaatcgccctcagtcaccagctacaggcagaacacctgtgtttgtg
agccccactcccccacctcctccaccacctcttccatctgccttgtcaacttcctcatta
agagcttcaatgacttcaactcctccccctccagtacctcccccacctccacctccagcc
actgctttgcaagctccagcagtaccaccgcctccagctcctcttcagattgcccctgga
gttcttcacccagctcctcctccaattgcacctcctctagtacagccctctccaccagta
gctagagctgccccagtatgtgagactgtaccagttcatccactcccacaaggtgaagtt
caggggctgcctccacccccaccaccgcctcctctgcctccacctggcattcgaccatca
tcacctgtcacagttacagctcttgctcatcctccctctgggctacatccaactccatct
actgccccaggtccccatgttccattaatgcctccatctcctccatcacaagttatacct
gcttctgagccaaagcgccatccatcaaccctacctgtaatcagtgatgccaggagtgtg
ctactggaagcaatacgaaaaggtattcagctacgcaaagtagaagagcagcgtgaacag
gaagctaagcatgaacgcattgaaaacgatgttgccaccatcctgtctcgccgtattgct
gttgaatatagtgattcggaagatgattcagaatttgatgaagtggattggttggagtaa

KEGG   Pongo abelii (Sumatran orangutan): 100437132
Entry
100437132         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: wiskott-Aldrich syndrome protein family member 2-like
  KO
K05748  WAS protein family, member 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04520  Adherens junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100437132
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100437132
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100437132
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100437132
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100437132
   05100 Bacterial invasion of epithelial cells
    100437132
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100437132
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     100437132
SSDB
Motif
Pfam: WH2 WASH_WAHD
Other DBs
NCBI-GeneID: 100437132
NCBI-ProteinID: XP_024096150
Ensembl: ENSPPYG00000020301
LinkDB
Position
X
AA seq 625 aa
MPRNKMSFSSPGQKVMYPPGYKTQGHGAEPSTSPLSSINYTIQSTETHRSLDKLLKGDID
IGSQNETDLFGFGNTHEYPDLQMMLFGALWCNIHKVSGKACLIFPHRGYNSSKLHNRGIC
LSLRSGSTMPLVTXNIEPRHLCRQRLPSVRSKLECVTNITLANVIRQLGSLSKYAEDIFG
ELFTQANTFASRVSSLAERVNGLQVKVTQLDPKEEEGSLQGINPRKAFRSSIIQDQKLFD
RNSLPVPVLETYKTCDTPPPLNNLTPYREDGKEALKFYTDPSYFFDLWKEKMLQDTKDIM
KEKRKHRKEKKDNPNRGDVNPCKIKTRKEEWEKIKMGQEFVESKEKVGPSGYPPTLVYQN
GSIGCVENMDASSYPPPSQSDSASSPSPSFEDNLPPPPAEFSYPVDNQRGSGLAGPKRSS
VVSPSHPPPVPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPLPVGFGSPGTPPPPSPP
SFPPHPDFAAPPPPPLPPAADYPTLPPPPLSQPTGGSPPSPPPPPPPGPPPPPFTGADGQ
PALPPPLSDTTKSKSSLPAVSDARSDLLSAIRQGFQLRRVEEQQEQEKRDVVGNDVATVV
SRLIAVEYSDSEDDSSEFDEDDWSD
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgcctagaaacaagatgtccttcagttctccaggacagaaagtcatgtatcccccaggg
tacaaaacccagggccatggggctgaaccctccacatcccccctctcctccatcaactac
actatacagtccactgaaacacacaggtctctggataagctgctgaaaggggacatagac
attggaagtcagaatgaaactgatttatttggatttggaaatactcatgagtacccagac
ttacagatgatgttgtttggagcattatggtgcaacatccataaggtctctgggaaagcc
tgccttatattcccacacagagggtacaacagcagtaaactccacaacagagggatatgc
ctatccctgcggtcggggtccaccatgccgttagtaacgnagaacatcgagccaaggcac
ctgtgccgtcagaggttgcctagcgttagaagcaagctggaatgcgtgaccaacatcacc
ctggcaaatgtcatccgacagctgggcagcctgagtaaatatgcagaggacatttttgga
gagctctttactcaggcaaatacctttgcctctcgggtaagctcccttgctgagagggtc
aacggactacaagttaaagtcactcagctggatcccaaggaagaagaagggtcactgcaa
ggaatcaacccccgaaaagccttcagaagctccatcattcaagaccagaagctttttgac
agaaactctctcccagtgcctgtcttagaaacatacaagacctgtgatactcctccccct
ctcaacaatcttaccccttacagggaagatggaaaagaggcactcaaattctacacagac
ccttcatacttctttgatctttggaaggagaagatgctgcaggacaccaaggatatcatg
aaagagaagagaaagcataggaaagaaaagaaagataatccaaatcgaggggatgtaaac
ccatgtaaaatcaagacacgtaaggaagagtgggagaaaattaagatggggcaagaattt
gtggagtccaaagaaaaggtggggccttctgggtatccacccaccttggtgtaccagaat
ggcagcattggctgtgttgaaaacatggatgcaagtagctatccaccaccatcacagtca
gactctgcttcttcaccttctccttccttcgaggacaacttgcctcctccaccagcagaa
ttcagttacccagtggacaaccaaagagggtctggtttggctggacccaaaagatccagt
gtggtcagcccaagccatccaccaccagttcctcctctaggctctccaccaggccctaaa
cccgggtttgctccaccacctgcccctccaccacctccacctccaatgataggcatccca
cctccaccactgcctgtaggatttgggtctccagggacgcctccaccaccctcaccccca
tctttcccacctcaccctgattttgctgcccctccacctcctcctctaccaccggcagct
gactacccaactctgccaccacctcccttgtcccagccaacaggaggatcacctccttct
ccccctcctcctcctcctccggggccccctcctccccctttcactggtgcagatggccag
cctgctctaccaccaccgctttctgataccaccaagtccaagtcctccttgcctgccgta
agcgatgcccgtagcgacctgctttcagccatccgtcaaggttttcagctgcgcagggtt
gaggagcagcaggaacaagagaagcgggatgtcgtgggcaatgacgtggccaccgtcgtg
tctcgtctcattgctgttgagtacagtgactcagaagatgactcctctgaatttgatgag
gacgactggtccgattaa

KEGG   Pongo abelii (Sumatran orangutan): 100445243
Entry
100445243         CDS       T01416                                 

Gene name
WASF3
Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 3 isoform X1
  KO
K06083  WAS protein family, member 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04520  Adherens junction
pon04666  Fc gamma R-mediated phagocytosis
pon05132  Salmonella infection
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100445243 (WASF3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100445243 (WASF3)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100445243 (WASF3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100445243 (WASF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100445243 (WASF3)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     100445243 (WASF3)
SSDB
Motif
Pfam: WH2 ChaB
Other DBs
NCBI-GeneID: 100445243
NCBI-ProteinID: XP_002824151
Ensembl: ENSPPYG00000005230
UniProt: A0A2J8UT65
LinkDB
Position
13
AA seq 502 aa
MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEAN
NFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTVQDQQVVSKNSIPNP
VADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQK
EQKRIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGSLSPDTRS
HASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNR
PQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFV
SPLQMPMQPPFPASAGSTHAAPPHPPSTGLLVTAPPPPGPPPPPPGPPGPGSSLSSSPMH
GPPVAEAKRQEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSR
RIAVEYSDSDDDSEFDENDWSD
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcctttagtgaagaggaacattgagccccggcacttgtgccggggagctctgcctgaa
gggattaccagcgaacttgaatgtgtaaccaatagtactcttgccgctatcatacgccag
ctgagcagtctgagcaaacatgctgaagacatatttggtgagttgtttaatgaggctaac
aacttctacatcagagcaaattctcttcaagacagaattgatcgccttgctgtcaaagtc
acccagctggattcaacagtggaagaggtctcactacaggatatcaacatgaaaaaagct
ttcaaaagttccacagtccaagaccagcaggtggtttcaaagaacagcattcccaatcct
gttgctgatatttacaaccagagtgataagccaccgcctctgaacatcctgacaccatac
agagatgacaagaaggatgggctgaagttctatactgatccttcctatttctttgacctc
tggaaagaaaaaatgctacaggacacagaagacaaaaggaaagagaaaaggcgtcaaaag
gagcaaaagcgtatagatggcaccacccgtgaggtgaaaaaggttagaaaagccagaaac
aggcgccaggagtggaatatgatggcatatgacaaagagcttagacccgacaacaggttg
tctcagagtgtgtaccacggagcgtcttccgagggatccctgtccccagatactaggtca
catgcgtcggatgttacagattactcttacccggctactcccaaccattctctgcacccc
cagcctgtgaccccttcctatgcagctggtgacgtgccaccacacgggcctgcaagccag
gctgcggagcatgagtaccggccgccatctgcctcggcgaggcacatggccctcaacaga
cctcagcagccgccgcccccgcctccccctcaggccccagaggggtcccaggcctctgca
ccgatggctccagcagactacgggatgctcccagcacagataattgagtattacaaccca
tccggaccacctcctccgccacctcctcctgtgattccctcagcacaaactgccttcgtc
agccctctccagatgcccatgcagcccccattccctgcatcagccggctccacgcacgca
gctcctcctcacccaccctccaccgggctcctggtcacagccccgccacccccgggccca
ccacctcccccgccaggccctcctggtcctgggtcttctctttcgtcctccccaatgcat
ggccccccagtagctgaggcgaagcggcaagagcctgcacagccaccaatcagtgatgct
cgaagcgacctcctcgctgctattcgaatgggaattcaactgaaaaaagtgcaggagcag
cgggagcaggaggccaagcgggagccggtggggaacgacgtggccacgatcctgtcccgg
cgcattgccgtggagtacagcgactctgacgatgactcagagttcgacgagaacgactgg
tccgactaa

KEGG   Pongo abelii (Sumatran orangutan): 100447501
Entry
100447501         CDS       T01416                                 

Gene name
WASF2
Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 2
  KO
K05748  WAS protein family, member 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04520  Adherens junction
pon04666  Fc gamma R-mediated phagocytosis
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100447501 (WASF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100447501 (WASF2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100447501 (WASF2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100447501 (WASF2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100447501 (WASF2)
   05100 Bacterial invasion of epithelial cells
    100447501 (WASF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100447501 (WASF2)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     100447501 (WASF2)
SSDB
Motif
Pfam: WH2 WASH_WAHD RasGAP
Other DBs
NCBI-GeneID: 100447501
NCBI-ProteinID: XP_024105235
Ensembl: ENSPPYG00000001661
LinkDB
Position
1
AA seq 498 aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVEN
VDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADNQRGSGLAGPKRSSVVSPSHP
PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPD
FAAPPPPPPPPAADYPTLPPPPLSQPTGGEPPPPPPPPPPGPPPPPFTGADGQPAVPPPL
SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVE
YSDSEDDSSEFDEDDWSD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgccgttagtaacgaggaacatcgagccaaggcacctgtgccgtcagacgttgcctagc
gttagaagcgagctggaatgcgtgaccaacatcaccctggcaaatgtcatccgacagctg
ggcagcctgagtaaatatgcagaggacatttttggagagctctttactcaggcaaatacc
tttgcctctcgggtaagctcccttgctgagagggtcgaccgactacaagttaaagtcact
cagctggatcccaaggaagaagaagtgtcactgcaaggaatcaacacccgaaaagccttc
agaagctccaccattcaagaccagaagctttttgacagaaactctctcccagtgcctgtc
ttagaaacatacaatacctgtgatactcctccccctctcaacaatcttaccccttacaga
gacgatggaaaagaggcactcaaattctacacagacccttcatacttctttgatctttgg
aaggagaagatgctgcaggacaccaaggatatcatgaaagagaagagaaagcataggaaa
gaaaagaaagataatccaaatcgagggaatgtaaacccacgtaaaatcaagacacgtaag
gaagagtgggagaaaatgaagatggggcaagaatttgtggagtccaaagaaaagctgggg
acttctgggtatccacccactttggtgtaccagaatggcagcattggctgtgttgaaaac
gtggatgcaagtagctatccgccaccaccacagtcagactctgcttcttcaccttctcct
tccttctccgaggacaacttgcctcctccaccagcagaattcagttacccagcggacaac
caaagaggatctggtttggctggacccaaaagatccagtgtggtcagcccaagccatcca
ccaccagctcctcctctaggctctccaccaggccctaaacccgggtttgctccaccacct
gcccctccgccacctccgcctccaatgataggcatcccacctccaccaccacctgtagga
tttgggtctccagggacacctccaccaccctcacccccatctttcccacctcaccctgat
tttgctgcccctccacctcctcctccaccaccagcagctgactacccgactctgccacca
cctcccttgtcccagccaacaggaggagaacctcctcctccccctcctcctcctcctccg
gggccccctcctccccctttcactggtgcagatggccagcctgctgtaccaccaccgctt
tctgataccaccaagcccaagtcctccttgcctgccgtgagcgatgcccgtagcgacctg
ctttcagccatccgtcaaggttttcagctgcgcagggttgaggagcagcgggaacaagag
aagcgggatgttgtgggcaatgacgtggccaccatcttgtctcgtcgcattgctgttgag
tacagtgactcagaagatgactcctctgaatttgatgaggacgactggtccgattaa

DBGET integrated database retrieval system