KEGG   Pongo abelii (Sumatran orangutan): 100174343
Entry
100174343         CDS       T01416                                 

Gene name
ACTN4
Definition
(RefSeq) alpha-actinin-4
  KO
K05699  actinin alpha 1/4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04530  Tight junction
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05146  Amoebiasis
pon05203  Viral carcinogenesis
pon05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100174343 (ACTN4)
   04520 Adherens junction
    100174343 (ACTN4)
   04530 Tight junction
    100174343 (ACTN4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100174343 (ACTN4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100174343 (ACTN4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100174343 (ACTN4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100174343 (ACTN4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100174343 (ACTN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100174343 (ACTN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100174343 (ACTN4)
   04147 Exosome [BR:pon04147]
    100174343 (ACTN4)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100174343 (ACTN4)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100174343 (ACTN4)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100174343 (ACTN4)
  Exosomal proteins of colorectal cancer cells
   100174343 (ACTN4)
  Exosomal proteins of bladder cancer cells
   100174343 (ACTN4)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 CAMSAP_CH EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 100174343
NCBI-ProteinID: NP_001127286
Ensembl: ENSPPYG00000009939
UniProt: Q5RCS6
LinkDB
Position
19
AA seq 911 aa
MVDYHAASQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICRVLAVNQENEHLMEDYEK
LASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
QTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
NELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPF
NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
NHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANV
VGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
DNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
HGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETT
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKS
FSTALYGESDL
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggtggactaccacgcggcgagccagtcgtaccagtacggccccagcagcgcgggcaat
ggcgctggcggcgggggcagcatgggcgactacatggcccaggaggacgactgggaccgg
gacctgctgctggacccggcctgggagaagcagcagcgcaagaccttcacggcgtggtgc
aactcccacttgcggaaggcaggcacacagatcgagaacattgatgaggacttccgagac
gggctcaagctcatgctgctcctggaggtcatatcaggggagcggttacctaagccggag
cgggggaagatgagagtgcacaaaatcaacaatgtgaacaaagcgctggactttattgcc
agcaaaggcgtcaagctggtctccatcggggcagaagagattgtggacggcaatgcaaag
atgaccctgggaatgatctggaccatcatccttaggttcgccatccaggacatctccgtg
gaagagacctcggccaaggaagggctccttctctggtgccagagaaagacagccccgtat
aagaacgtcaatgtgcagaacttccacatcagctggaaggatggtcttgccttcaatgcc
ctgatccaccggcacagaccagagctgattgagtatgacaagctgaggaaggacgaccct
gtcaccaacctgaacaatgccttcgaagtggctgagaaatacctcgacatccccaagatg
ctggatgcagaggacatcgtgaacacggcccggcccgacgagaaggccataatgacctat
gtgtccagcttctaccatgccttttcaggagcgcagaaggctgaaactgccgccaaccgg
atctgcagggtgttggctgtcaaccaagagaacgagcacttgatggaggactacgagaag
ctggccagcgatctcctggagtggatccggcgcaccatcccctggctggaggaccgtgtg
ccccaaaagactatccaggagatgcagcagaagctggaggacttccgcgactaccggcgc
gtgcacaagccgcccaaggtgcaggagaagtgccagctggagatcaacttcaacacactg
cagaccaagctgcgcctcagcaaccggcccgccttcatgccctccgagggcaagatggtc
tcggacatcaacaacggctggcagcacttggagcaggctgagaagggctatgaggaatgg
ctgctgaatgagatccgcaggctggagcggctcgaccacctggcagagaagttccggcag
aaggcctccatccacgaggcctggactgacgggaaggaagccatgctgaagcaccgagac
tacgagacggccacgctatcggacatcaaagccctcattcgcaagcacgaggccttcgag
agtgacctggccgcgcaccaggaccgcgtggagcagatcgccgccattgcccaggagctc
aacgagctggattactacgactcccacaatgtcaacacccggtgccagaagatctgcgac
cagtgggacgccctcggctctctgacgcacagtcgcagggaagccctggagaaaacagag
aagcagctggaggccatcgaccagctgcacctggagtatgccaagcgcgcagccccattc
aacaactggatggagagcgccatggaggacctccaggacatgttcattgtccataccatc
gaggagattgagggcctgatctcagcccacgaccagttcaagtccaccctgccggacgcc
gacagggagcgcgaggccatcctggccatccacaaggaggcccagaggatcgctgaaagt
aaccacatcaagctgtcgggcagcaacccctacaccactgtcaccccacagatcatcaac
tccaagtgggagaaggtacagcagctggtgccaaaacgggaccacgccctcctggaggag
cagagcaagcagcagtccaacgagcacctgcgccgccagtttgccagccaggccaacgtc
gtggggccctggatccagaccaagatggaggagatcgggcgcatctccattgagatgaac
gggaccctggaggaccagctgagccacctgaagcagtatgaacgcagcatcgtggactac
aagcctaacctggacctgctggagcagcagcaccagctcatccaggaggccctcatcttc
gacaacaagcacaccaactataccatggagcacatccgtgtgggctgggagcagctgctc
accaccattgcccgcaccatcaatgaggtggagaaccagatcctcacccgcgacgccaag
ggcatcagccaggagcagatgcaggagttccgggcgtccttcaaccacttcgacaaggat
catggcggggcgctggggcccgaggagttcaaggcctgcctcatcagcctgggctacgac
gtggagaacgaccggcagggtgaggccgagttcaaccgcatcatgagcctggtcgacccc
aaccatagtggccttgtgaccttccaagccttcatcgacttcatgtcgcgggagaccacc
gacacggacacggccgaccaggtcatcgcttccttcaaggtcctggcaggggacaagaac
ttcatcacagctgaggagctgcggagagagctgccccccgaccaggctgagtactgcatc
gcccgcatggcgccgtaccagggccctgatgccgtgcccggcgcccttgactacaagtcc
ttctccacagccctgtatggcgagagcgacctgtga

KEGG   Pongo abelii (Sumatran orangutan): 100460195
Entry
100460195         CDS       T01416                                 

Gene name
ACTN1
Definition
(RefSeq) alpha-actinin-1 isoform X1
  KO
K05699  actinin alpha 1/4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04530  Tight junction
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05146  Amoebiasis
pon05203  Viral carcinogenesis
pon05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100460195 (ACTN1)
   04520 Adherens junction
    100460195 (ACTN1)
   04530 Tight junction
    100460195 (ACTN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460195 (ACTN1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100460195 (ACTN1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100460195 (ACTN1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100460195 (ACTN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100460195 (ACTN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100460195 (ACTN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100460195 (ACTN1)
   04147 Exosome [BR:pon04147]
    100460195 (ACTN1)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100460195 (ACTN1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100460195 (ACTN1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100460195 (ACTN1)
  Exosomal proteins of colorectal cancer cells
   100460195 (ACTN1)
  Exosomal proteins of bladder cancer cells
   100460195 (ACTN1)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 EF-hand_7 CAMSAP_CH EF-hand_8 EF-hand_5 XisI
Other DBs
NCBI-GeneID: 100460195
NCBI-ProteinID: XP_024087662
Ensembl: ENSPPYG00000005935
LinkDB
Position
14
AA seq 1020 aa
MPGIPNERRWGEVWATRPGQWRASGGLCPFPPPPPASAHAALVCPPSSVCVEIRSKRPPR
GRQSASPAAAVAASSSLRQQRRGGTGRRGASPAPPAQPSPTPSPRQGSSRCSERRWRKKS
RPQHARTIMDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQI
ENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGA
EEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHIS
WKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTAR
PDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRR
TIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPA
FMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDG
KEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSV
NARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDL
QDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPY
TTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEE
IGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEH
IRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFK
ACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMAS
FKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgccaggaattcccaatgagaggcgatggggggaagtttgggcaactcggcctggccaa
tggagagcctcgggagggctctgccccttccccccgcccccgcccgcctcggctcacgca
gcgctagtgtgtccgcctagctcagtgtgcgtggagattaggtccaagcgcccgcccaga
ggcaggcagtccgcgagcccagccgccgctgtcgccgccagtagcagccttcgccagcag
cgccgcggcggaaccgggcgcaggggagcgagcccggccccgccagcccagcccagccct
actccctccccacgccagggcagcagccgttgctcagagagaaggtggaggaagaaatcc
agaccccagcacgcgcgcaccatcatggaccattatgattctcagcaaaccaacgattac
atgcagccagaagaggactgggaccgggacctgctcctggacccggcctgggagaagcag
cagagaaagacattcacggcatggtgtaactcccacctccggaaggcggggacacagatc
gagaacatcgaagaggacttccgggatggcctgaagctcatgctgctgctggaggtcatc
tcaggtgaacgcttggctaagccagagcgaggcaagatgagagtgcacaagatctccaac
gtcaacaaggccctggatttcatagctagcaaaggcgtcaaactggtgtccatcggagcc
gaagaaatcgtggatgggaatgtgaagatgaccctgggcatgatctggaccatcatcctg
cgctttgccatccaggacatctctgtggaagagacttcagctaaggaagggctgctcctg
tggtgtcagagaaagacagccccttacaaaaacgtcaacatccagaacttccacataagc
tggaaggatggcctcggcttctgtgccttgattcaccgacaccggcccgagctgattgac
tacgggaagctgcggaaggatgatccactcacaaatctgaatacggcttttgacgtggca
gagaagtacctggacatccctaagatgctggatgccgaagacatcgttggaactgcccga
ccggatgagaaagccatcatgacttatgtgtctagcttctaccacgccttctctggagcc
cagaaggcggagacagcagccaatcgcatctgcaaggtgttggccgtcaaccaggagaac
gagcagcttatggaagactacgagaagttggccagtgatctgttggagtggatccgccgc
acaatcccgtggctggagaaccgggtgcccgagaacaccatgcatgccatgcagcagaag
ctggaggatttccgggactaccggcgcctgcacaagccgcccaaggtgcaggagaagtgc
cagctggagatcaacttcaacacgctgcagaccaagctgcggctcagcaaccggcctgcc
ttcatgccctctgagggcaggatggtctcggacatcaacaatgcctggggctgcctggag
caggtggagaagggctatgaggagtggttgctgaacgagatccggaggctggagcgactg
gaccacctggcagagaagttccggcagaaggcctccatccacgaggcctggactgacggc
aaagaggccatgctgcgacagaaggactatgagacagccaccctctcggagatcaaggcc
ctgctcaagaagcatgaggccttcgagagtgacctggctgcccaccaggaccgcgtggag
cagattgccgccatcgcacaggagctcaatgagctggactattatgactcacccagtgtc
aacgcccgttgccaaaagatctgtgaccagtgggacaatctgggggccctaactcagaag
cgaagggaagctctggagcggaccgagaaactgctggagaccattgaccagctgtacttg
gagtatgccaagcgggctgcacccttcaacaactggatggagggggccatggaggacctg
caggacaccttcattgtgcacaccattgaggagatccagggactgaccacagcccatgag
cagttcaaggccaccctccctgatgccgacaaggagcgcctggccatactgggcatccac
aacgaggtgtccaagattgtccagacctaccacgtcaatatggcgggcaccaacccctac
acaaccatcacgcctcaggagatcaatggcaaatgggaccacgtgcggcagctggtgcca
cggagggaccaagctctgacggaggagcatgcccgacagcagcacaatgagaggctacgc
aagcagtttggggcccaggccaatgtcatcgggccctggatccagaccaagatggaggag
atcgggaggatctccattgagatgcacgggaccctggaggaccagctcagccacctgcgg
cagtatgagaagagtatcgtcaactacaagccaaagattgatcagctggagggcgaccac
cagctcatccaggaggcactcatctttgacaacaagcacaccaactacaccatggagcac
atccgtgtgggctgggagcagctgctcaccaccatcgccaggaccatcaatgaggtggag
aaccagatcctgacccgggatgccaagggcattagccaggagcagatgaatgagttccgg
gcctccttcaaccactttgaccgggatcactccggcacactgggtcccgaggagttcaaa
gcctgcctcatcagcttgggttatgatattggcaacgacccccagggagaagcagaattt
gcccgcatcatgagcattgtggaccccaaccgcctgggggtagtgacattccaggccttc
attgacttcatgtcccgcgagacagccgacacagatacagcagaccaagtcatggcttcc
ttcaagatcctggccggggacaagaactacattaccatggacgagctgcgccgcgagctg
ccgcccgaccaggctgagtactgcatcgcgcggatggccccctacaccggccccgactcc
gtgccaggtgctctggactacatgtccttctccacggcgctgtacggcgagagtgacctc
taa

DBGET integrated database retrieval system