KEGG   Pongo abelii (Sumatran orangutan): 100174530
Entry
100174530         CDS       T01416                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04625  C-type lectin receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04720  Long-term potentiation
pon04724  Glutamatergic synapse
pon04728  Dopaminergic synapse
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05152  Tuberculosis
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100174530 (PPP3CA)
   04310 Wnt signaling pathway
    100174530 (PPP3CA)
   04370 VEGF signaling pathway
    100174530 (PPP3CA)
   04020 Calcium signaling pathway
    100174530 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    100174530 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100174530 (PPP3CA)
   04218 Cellular senescence
    100174530 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100174530 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    100174530 (PPP3CA)
   04660 T cell receptor signaling pathway
    100174530 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    100174530 (PPP3CA)
   04659 Th17 cell differentiation
    100174530 (PPP3CA)
   04662 B cell receptor signaling pathway
    100174530 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100174530 (PPP3CA)
   04921 Oxytocin signaling pathway
    100174530 (PPP3CA)
   04924 Renin secretion
    100174530 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100174530 (PPP3CA)
   04728 Dopaminergic synapse
    100174530 (PPP3CA)
   04720 Long-term potentiation
    100174530 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100174530 (PPP3CA)
   04380 Osteoclast differentiation
    100174530 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100174530 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100174530 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    100174530 (PPP3CA)
   05020 Prion disease
    100174530 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    100174530 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100174530 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100174530 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100174530 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    100174530 (PPP3CA)
   05163 Human cytomegalovirus infection
    100174530 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100174530 (PPP3CA)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100174530 (PPP3CA)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100174530 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 100174530
NCBI-ProteinID: NP_001127457
Ensembl: ENSPPYG00000014960
UniProt: Q5R914
LinkDB
Position
4
AA seq 511 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM
PSDANLNSINKALTSETNGTDSNGSNSSNIQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gttccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatggaaaa
cctcgtgtggatatcttaaaggcacatcttatgaaggagggaaggctggaagagagtgtt
gcattgagaataataacagagggtgcatcaattcttcgacaggaaaaaaatttgctggat
attgatgcaccagtcacagtttgtggggacattcatggacaattctttgacttgatgaag
ctctttgaagtcgggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtatatgacgcctgtatggat
gcctttgactgccttcccctggctgccctgatgaaccaacagttcctgtgtgtacatggt
ggtttgtctccagagattaacactttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcatatggacctatgtgtgatatcctgtggtcagaccccctggaagattttgga
aatgagaagactcaggaacatttcactcacaacacagtcagggggtgttcgtacttctac
agctacccggctgtatgtgaattcttacagcacaataacttgttatctatacttcgagcc
cacgaagcccaagatgcagggtaccgcatgtacaggaaaagccaaacaacaggcttccct
tctctaattacaattttttcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgttatgaatatcaggcaattcaactgctctcctcatcca
tactggcttccaaatttcatggatgtttttacttggtcccttccatttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagatgatgaactagggtcagaa
gaagatggatttgatggtgcaacagctgcagcccggaaagaggtgataaggaacaagatc
cgagcaataggcaaaatggccagagtgttctcagtgctcagagaagagagtgagagtgtg
ctgacgctgaaaggcttgaccccaactggcatgctccccagcggagtactttctggaggg
aagcaaaccctgcaaagcgctatcaaaggattttcaccacaacataagatcactagcttc
gaggaagccaagggcttagaccgaattaatgagaggatgccgcctcgcagagatgccatg
ccctctgatgccaaccttaactccatcaacaaggctctcacctcagagactaacggcacg
gacagcaatggcagtaatagcagcaatattcagtga

KEGG   Pongo abelii (Sumatran orangutan): 100436675
Entry
100436675         CDS       T01416                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X9
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04625  C-type lectin receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04720  Long-term potentiation
pon04724  Glutamatergic synapse
pon04728  Dopaminergic synapse
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05152  Tuberculosis
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100436675 (PPP3CB)
   04310 Wnt signaling pathway
    100436675 (PPP3CB)
   04370 VEGF signaling pathway
    100436675 (PPP3CB)
   04020 Calcium signaling pathway
    100436675 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    100436675 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100436675 (PPP3CB)
   04218 Cellular senescence
    100436675 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100436675 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    100436675 (PPP3CB)
   04660 T cell receptor signaling pathway
    100436675 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    100436675 (PPP3CB)
   04659 Th17 cell differentiation
    100436675 (PPP3CB)
   04662 B cell receptor signaling pathway
    100436675 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100436675 (PPP3CB)
   04921 Oxytocin signaling pathway
    100436675 (PPP3CB)
   04924 Renin secretion
    100436675 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100436675 (PPP3CB)
   04728 Dopaminergic synapse
    100436675 (PPP3CB)
   04720 Long-term potentiation
    100436675 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100436675 (PPP3CB)
   04380 Osteoclast differentiation
    100436675 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100436675 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100436675 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    100436675 (PPP3CB)
   05020 Prion disease
    100436675 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    100436675 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100436675 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100436675 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100436675 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    100436675 (PPP3CB)
   05163 Human cytomegalovirus infection
    100436675 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100436675 (PPP3CB)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100436675 (PPP3CB)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100436675 (PPP3CB)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 100436675
NCBI-ProteinID: XP_009243749
Ensembl: ENSPPYG00000002337
LinkDB
Position
10
AA seq 457 aa
MIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLK
ILYPSTLFLLRGNHECRHLTEYFTFKQECEYCQEKCFHFLSILLDLSKIKYSERVYEACM
EAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDF
GNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGF
PSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGE
KVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESE
SVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDR
INERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgatagaagtagaagctccaatcacagtgtgtggtgacatccatggccaattttttgat
ctgatgaaactttttgaagtaggaggatcacctgctaatacgcgatacctttttcttggc
gattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggttctgaag
attctatacccaagcacattatttcttctgagaggcaaccatgaatgcagacaccttact
gaatattttacctttaagcaggaatgtgagtactgccaggagaaatgttttcacttcctc
agtattcttttggacttaagtaaaattaagtattcggaaagagtctatgaagcttgtatg
gaagcttttgatagtttgcctcttgctgcacttttaaaccaacagtttctttgtgttcat
ggtggactttcaccagaaatacacacactggatgatattaggagattagatagattcaaa
gagccacctgcatttggaccaatgtgtgacttgttatggtccgatccttctgaagatttt
ggaaatgaaaaatcacaggaacattttagtcacaatacagttcgaggatgttcttatttt
tataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcgattattaga
gctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaactacagggttc
ccttcattaataacaattttttcggcacctaattacttagatgtctacaataataaagct
gctgtattaaagtatgaaaataatgtgatgaatattcgacagtttaactgttctccacat
ccttactggttgcctaattttatggatgtcttcacgtggtctttaccgtttgttggagaa
aaagtgacagaaatgttggtaaatgttctgagtatttgctctgatgatgaactaatgact
gaaggtgaagaccagtttgatgtaggttcagctgcagcccggaaagaaatcataagaaac
aaaattcgagcaattggcaagatggcaagagtcttctctgttctcagggaggagagtgaa
agtgtgctgacactcaagggcctgactcccacagggatgttgcctagtggagtgttagct
ggaggacggcagaccctgcaaagtgccacagttgaggctattgaggctgaaaaagcaata
cgaggattctctccaccacatagaatctgcagttttgaagaggcaaagggtttggatagg
atcaatgagagaatgccacctcggaaagatgctgtacagcaagatggtttcaattctctg
aacaccgcacatgccactgagaaccacgggacgggcaaccatactgcccagtga

KEGG   Pongo abelii (Sumatran orangutan): 100455542
Entry
100455542         CDS       T01416                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04625  C-type lectin receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04720  Long-term potentiation
pon04724  Glutamatergic synapse
pon04728  Dopaminergic synapse
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05152  Tuberculosis
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100455542 (PPP3CC)
   04310 Wnt signaling pathway
    100455542 (PPP3CC)
   04370 VEGF signaling pathway
    100455542 (PPP3CC)
   04020 Calcium signaling pathway
    100455542 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    100455542 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100455542 (PPP3CC)
   04218 Cellular senescence
    100455542 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100455542 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    100455542 (PPP3CC)
   04660 T cell receptor signaling pathway
    100455542 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    100455542 (PPP3CC)
   04659 Th17 cell differentiation
    100455542 (PPP3CC)
   04662 B cell receptor signaling pathway
    100455542 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100455542 (PPP3CC)
   04921 Oxytocin signaling pathway
    100455542 (PPP3CC)
   04924 Renin secretion
    100455542 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    100455542 (PPP3CC)
   04728 Dopaminergic synapse
    100455542 (PPP3CC)
   04720 Long-term potentiation
    100455542 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    100455542 (PPP3CC)
   04380 Osteoclast differentiation
    100455542 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100455542 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100455542 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    100455542 (PPP3CC)
   05020 Prion disease
    100455542 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    100455542 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    100455542 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100455542 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100455542 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    100455542 (PPP3CC)
   05163 Human cytomegalovirus infection
    100455542 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100455542 (PPP3CC)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100455542 (PPP3CC)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100455542 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 100455542
NCBI-ProteinID: XP_002818927
Ensembl: ENSPPYG00000018422
UniProt: H2PPS1
LinkDB
Position
8
AA seq 511 aa
MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
KDSIHADGPMKSVTSAHSHAAHRSDQGKKAQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgggaggcgcttccacctctccaccaccgaccgcgtcatcaaagctgtccccttt
cctccaacccaacggcttactttcaaggaagtatttgagaatgggaaacctaaagttgat
gttttaaaaaaccatttggtaaaggaaggacgactggaagaggaagtagccttaaagata
atcaatgatggggctgccatcctgaggcaagagaagactatgatagaagtagatgctcca
atcacagtatgtggtgatattcatggacaattctttgacctaatgaagttatttgaagtt
ggaggatcacctagtaatacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtatttatggagtttaaagattaatcatcccaaaacattg
tttctgcttcggggaaatcatgaatgcaggcatcttacagactatttcaccttcaaacag
gaatgtcgaatcaaatattcggaacaggtgtatgatgcctgtatggagacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctctgtgtacatggaggaatgtcacct
gaaattacttctttagatgacattaggaaattagacaggtttacggaacctcccgcgttt
ggacctgtgtgtgacctgctttggtctgatccctcagaggattatggcaatgagaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttctacagttaccctgca
gtttgtgaatttttgcagaacaataatttactatcaattatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccaagcaacaggctttccatcacttattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttgaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggatgttttcacatggtctttgccttttgttggggaaaaagtcacagagatg
ctggtaaatgtgctcaacatatgctctgatgacgaactgatttctgatgatgaagcagaa
ggaagcactacagttcgtaaggagatcatcaggaataagatcagagccattgggaagatg
gcacgggtcttttcaattcttcggcaagaaagtgagagtgtactgactctcaagggcctg
actcccacaggcacgctccctctgggcgtcctctcaggaggcaagcagactatcgagaca
gccacagtagaagcggtagaggcccgggaagccatcagagggttctcgcttcagcacaag
attcggagttttgaagaagcgcgaggtctggaccgaattaatgagcgaatgccaccccga
aaggatagcatacacgctgatgggccaatgaaatctgtaacctcagcacactcacatgct
gcacacaggagcgaccaagggaagaaagcccagtaa

KEGG   Pongo abelii (Sumatran orangutan): 100461146
Entry
100461146         CDS       T01416                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04625  C-type lectin receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04720  Long-term potentiation
pon04724  Glutamatergic synapse
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05152  Tuberculosis
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100461146 (PPP3R2)
   04310 Wnt signaling pathway
    100461146 (PPP3R2)
   04370 VEGF signaling pathway
    100461146 (PPP3R2)
   04020 Calcium signaling pathway
    100461146 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    100461146 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100461146 (PPP3R2)
   04218 Cellular senescence
    100461146 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100461146 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    100461146 (PPP3R2)
   04660 T cell receptor signaling pathway
    100461146 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    100461146 (PPP3R2)
   04659 Th17 cell differentiation
    100461146 (PPP3R2)
   04662 B cell receptor signaling pathway
    100461146 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100461146 (PPP3R2)
   04921 Oxytocin signaling pathway
    100461146 (PPP3R2)
   04924 Renin secretion
    100461146 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100461146 (PPP3R2)
   04720 Long-term potentiation
    100461146 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    100461146 (PPP3R2)
   04380 Osteoclast differentiation
    100461146 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100461146 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100461146 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    100461146 (PPP3R2)
   05020 Prion disease
    100461146 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    100461146 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    100461146 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100461146 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100461146 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    100461146 (PPP3R2)
   05163 Human cytomegalovirus infection
    100461146 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100461146 (PPP3R2)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100461146 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Other DBs
NCBI-GeneID: 100461146
NCBI-ProteinID: XP_009242979
LinkDB
Position
9
AA seq 173 aa
MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR
VIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK
MMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtccacaatgggaaacgaggccagttacccggcggagatgtgctcccactttgacaat
gatgaaattaaaaggctgggcaggaggtttaagaagttggacttggacaaatcagggtct
ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggaga
gtgatcgacgtcttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctg
gggacctcccagttcagcgtcaagggcgacgaggagcagaagttgagatttgcgttcagc
atttacgacatggataaagatggctatatttccaacggggagctcttccaggtgctgaag
atgatggtgggcaacaacctgacggactggcagctccagcagctggtcgacaaaaccatc
atcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc
agagacctggagatccacaagaagctggtcctcatcgtgtga

KEGG   Pongo abelii (Sumatran orangutan): 103889825
Entry
103889825         CDS       T01416                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04625  C-type lectin receptor signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04720  Long-term potentiation
pon04724  Glutamatergic synapse
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04924  Renin secretion
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05031  Amphetamine addiction
pon05152  Tuberculosis
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103889825 (PPP3R1)
   04310 Wnt signaling pathway
    103889825 (PPP3R1)
   04370 VEGF signaling pathway
    103889825 (PPP3R1)
   04020 Calcium signaling pathway
    103889825 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    103889825 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103889825 (PPP3R1)
   04218 Cellular senescence
    103889825 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103889825 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    103889825 (PPP3R1)
   04660 T cell receptor signaling pathway
    103889825 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    103889825 (PPP3R1)
   04659 Th17 cell differentiation
    103889825 (PPP3R1)
   04662 B cell receptor signaling pathway
    103889825 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103889825 (PPP3R1)
   04921 Oxytocin signaling pathway
    103889825 (PPP3R1)
   04924 Renin secretion
    103889825 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103889825 (PPP3R1)
   04720 Long-term potentiation
    103889825 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    103889825 (PPP3R1)
   04380 Osteoclast differentiation
    103889825 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103889825 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103889825 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    103889825 (PPP3R1)
   05020 Prion disease
    103889825 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    103889825 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    103889825 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103889825 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103889825 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    103889825 (PPP3R1)
   05163 Human cytomegalovirus infection
    103889825 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103889825 (PPP3R1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     103889825 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 103889825
NCBI-ProteinID: XP_009235510
UniProt: A0A2J8XBZ9
LinkDB
Position
2A
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcggatgaaatt
aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atattcgacacagatgggaatggagaagtagactttaaagaattcattgagggcgtctct
cagttcagtgtcaaaggagataaggagcagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtattgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system