KEGG   Pongo abelii (Sumatran orangutan): 100174544
Entry
100174544         CDS       T01416                                 

Gene name
GSTP1
Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00480  Glutathione metabolism
pon00980  Metabolism of xenobiotics by cytochrome P450
pon00982  Drug metabolism - cytochrome P450
pon00983  Drug metabolism - other enzymes
pon01100  Metabolic pathways
pon01524  Platinum drug resistance
pon05200  Pathways in cancer
pon05204  Chemical carcinogenesis
pon05215  Prostate cancer
pon05225  Hepatocellular carcinoma
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100174544 (GSTP1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100174544 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    100174544 (GSTP1)
   00983 Drug metabolism - other enzymes
    100174544 (GSTP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100174544 (GSTP1)
   05204 Chemical carcinogenesis
    100174544 (GSTP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100174544 (GSTP1)
   05215 Prostate cancer
    100174544 (GSTP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100174544 (GSTP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100174544 (GSTP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100174544 (GSTP1)
Enzymes [BR:pon01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100174544 (GSTP1)
Transporters [BR:pon02000]
 Other transporters
  Pores ion channels [TC:1]
   100174544 (GSTP1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 100174544
NCBI-ProteinID: NP_001127471
UniProt: Q5R8R5 A0A2J8U0H6
LinkDB
Position
11
AA seq 210 aa
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVSMETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYLSLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VARLSARPKLKAFLASPEHVNLPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccctacaccgtggtctatttcccagttcgaggccgctgcgcggccctgcgcatg
ctgctggcagaccagggccagagctggaaggaggaggtggtgtccatggagacgtggcag
gagggctcactcaaagcctcctgcctatacgggcagctccccaagttccaggacggagac
ctcaccctgtaccagtccaataccatcctgcgtcacctgggccgcacccttgggctctat
gggaaggaccagcgggaggcagccctggtggacatggtgaatgacggcgtggaggacctc
cgctgcaaatacctctctctcatctacaccaactatgaggcgggcaaggatgactatgtg
aaggcattgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc
aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggatttgctg
ctgatccatgaggtcctggcccctggctgcctggatgcgttccccctgctctcagcgtat
gtggcacgcctcagcgcccggcccaagctcaaggccttcctggcctcccctgagcacgtg
aacctccccatcaatggcaacgggaaacagtga

DBGET integrated database retrieval system