KEGG   Pongo abelii (Sumatran orangutan): 100431221
Entry
100431221         CDS       T01416                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00230  Purine metabolism
pon01100  Metabolic pathways
pon01522  Endocrine resistance
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04725  Cholinergic synapse
pon04727  GABAergic synapse
pon04740  Olfactory transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04916  Melanogenesis
pon04918  Thyroid hormone synthesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04925  Aldosterone synthesis and secretion
pon04926  Relaxin signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon04935  Growth hormone synthesis, secretion and action
pon04962  Vasopressin-regulated water reabsorption
pon04970  Salivary secretion
pon04971  Gastric acid secretion
pon04972  Pancreatic secretion
pon04976  Bile secretion
pon05032  Morphine addiction
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100431221 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100431221 (ADCY3)
   04371 Apelin signaling pathway
    100431221 (ADCY3)
   04020 Calcium signaling pathway
    100431221 (ADCY3)
   04072 Phospholipase D signaling pathway
    100431221 (ADCY3)
   04024 cAMP signaling pathway
    100431221 (ADCY3)
   04022 cGMP-PKG signaling pathway
    100431221 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100431221 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100431221 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100431221 (ADCY3)
   04062 Chemokine signaling pathway
    100431221 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    100431221 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    100431221 (ADCY3)
   04912 GnRH signaling pathway
    100431221 (ADCY3)
   04913 Ovarian steroidogenesis
    100431221 (ADCY3)
   04915 Estrogen signaling pathway
    100431221 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    100431221 (ADCY3)
   04921 Oxytocin signaling pathway
    100431221 (ADCY3)
   04926 Relaxin signaling pathway
    100431221 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    100431221 (ADCY3)
   04918 Thyroid hormone synthesis
    100431221 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    100431221 (ADCY3)
   04916 Melanogenesis
    100431221 (ADCY3)
   04925 Aldosterone synthesis and secretion
    100431221 (ADCY3)
   04927 Cortisol synthesis and secretion
    100431221 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100431221 (ADCY3)
   04270 Vascular smooth muscle contraction
    100431221 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    100431221 (ADCY3)
   04971 Gastric acid secretion
    100431221 (ADCY3)
   04972 Pancreatic secretion
    100431221 (ADCY3)
   04976 Bile secretion
    100431221 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100431221 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100431221 (ADCY3)
   04727 GABAergic synapse
    100431221 (ADCY3)
   04725 Cholinergic synapse
    100431221 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    100431221 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    100431221 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    100431221 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    100431221 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    100431221 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100431221 (ADCY3)
   04714 Thermogenesis
    100431221 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431221 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    100431221 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100431221 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100431221 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100431221 (ADCY3)
   05163 Human cytomegalovirus infection
    100431221 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100431221 (ADCY3)
Enzymes [BR:pon01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100431221 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 100431221
NCBI-ProteinID: XP_024098015
Ensembl: ENSPPYG00000012595
LinkDB
Position
2A
AA seq 1158 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLALLAVAGIGLVLDII
LFVLCKKGLLPDRVTRRVVPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKIATQNGLNGSALPNGAPVSSKSSSPALIETKEPNGSAHS
SGSMSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFVVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPGNATAGMETEGGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVATINLYAWRPIFDEYDHKRFREHDLPMVALEKMQGFTPRLNGTDSRLPLVPSK
YSMTAMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVCPGAEPARAQTQGMGTKPDSAFPRALPPTLAPGPWPRTVSPRAEAWGQWKGVSA
VASLSSGRNTSTHPQNLG
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcccgaatactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactccggctcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctctaccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgcagccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctggctctcctcgccgtggctggaattggactggtgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccgcagagtggtgccc
tacgtgctgtggctgctcataaccgcccagatcttctcctacctgggcctgaacttcgcg
cgtgcccacgcggctagtgacacggtgggctggcaggtcttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtgatcatctccgtggtctcctgtgtggtg
cacacgttggtcctgggggtcaccgtggcccagcagcagcaggaggagctgaaggggatg
cagctgctgcgggagatcctggccaacgtcttcctctacctgtgcgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaagacatgaagaaagacgagagc
cagaaggatcagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
ctctttgctgacatcgtgggctttacccagctgtcttctgcctgcagtgcccaggagctc
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcttgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctggccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtcgactgatgtcact
gtagccaacaagatggaggccggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggagccaggcgatgggggcagccgctgtgat
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaatagccacccagaatggcctcaatggctcggccctgcccaatggagcgccagtttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaatgggagtgcccacagc
agcgggtccatgtcagagaagcccgaggagcaggatgcccaggccgacaacccctcattc
cccaacccacgccggaggctgcgcctgcaggacctggctgaccgagtggtggacgcctct
gaagatgagcacgagctcaaccagctgctcaacgaggccctgctcgagcgagagtctgcc
caagtagtaaagaagagaaacaccttcctcttgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggccctggtcgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcgtggtaggggagattctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcgacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatccttgtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacgggacccggcaatgcgacggcaggg
atggagacggagggcggctgcctggagaaccccaagtattacaactacgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgctcgtcgcgggcgccgtggccaccatcaacctctatgcctggcgccccatctttgat
gaatacgaccacaagcgttttcgggagcatgacttacctatggtggccttagagaagatg
caaggattcacccctaggctcaacggcactgacagcaggctgcccctggtgccttccaag
tactccatgacggcgatggtgttcctcatgatgctgagcttctactacttctcccgccat
gtagaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtatagtcagacgtat
gatgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggag
agcatcaacaatggtggtattgagtgtctgcgttttctcaatgaaatcatctcggatttt
gactctctcctggacaatcccaagttccgtgtgatcaccaagatcaaaaccattggcagc
acgtatatggcggcttcaggagtcacccccgatgtcaacaccaatggctttgccagttcc
aacaaggaggacaagtccgagagagagcgctggcagcacctggctgacctggccgacttc
gcgctggccatgaaggatacgctcaccaacatcaacaaccagtccttcaataacttcatg
ctgcgcataggcatgaacaaaggcggggttctggctggggtcatcggagcccggaaacca
cactacgacatctggggcaatacagtcaatgtagccagcaggatggagtccacgggggtc
atgggcaacattcaggtatgtccaggggcagagccggcacgtgctcagactcagggcatg
ggaacaaaaccggacagtgctttcccacgcgccctgcctcccacactggcccctggcccc
tggccccgaacagtgagtccgcgggcagaggcgtggggccagtggaaaggagtctctgca
gtagctagcctcagctcagggagaaacacttccacccatccacaaaatctgggctga

DBGET integrated database retrieval system