KEGG   Pongo abelii (Sumatran orangutan): 100431606
Entry
100431606         CDS       T01416                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00310  Lysine degradation
pon01100  Metabolic pathways
pon04010  MAPK signaling pathway
pon05200  Pathways in cancer
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100431606 (MECOM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100431606 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100431606 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100431606 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100431606 (MECOM)
   03036 Chromosome and associated proteins [BR:pon03036]
    100431606 (MECOM)
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     100431606 (MECOM)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    100431606 (MECOM)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100431606 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_11 zf-C2H2_8 PyrI_C
Other DBs
NCBI-GeneID: 100431606
NCBI-ProteinID: XP_024100839
Ensembl: ENSPPYG00000014277
LinkDB
Position
3
AA seq 1052 aa
MKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQ
KLESENDLQEIHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHK
HIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGF
SFSFPGLFPSGLYHRPPLIPASSPVKGLPSTEQTNKSQSPLMTHPQILPATQDILKALSK
HPSVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIES
DKEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIAS
IAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSP
GEVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPVTTATSQDQPLDLSMGSRSRASGTK
LTEPRKNHVFGEKKGSNIESRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKY
LRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPN
ALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH
VRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDK
EDAYFTEIRNFIVNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLL
DEEDEDNDITGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSGLSAL
DHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKE
SLHSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgaagagcgaagactatccccatgaaactatggcgccggatatccacgaagaacggcaa
tatcgctgtgaagactgtgaccagctctttgaatctaaggctgaactagcagatcaccaa
aagtttccatgcagtactcctcattcagcattttcaatggttgaagaggattttcagcaa
aaactcgaaagcgagaatgatctccaagagatacacacgatccaggagtgtaaggaatgt
gaccaagtttttcctgatttgcaaagcctggagaaacacatgctgtcacatactgaagag
agggaatacaagtgtgatcagtgtcccaaggcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgaatgtgaaaactgtgccaagcaggtt
ttcacggaccctagcaaccttcagcggcacattcgctctcagcatgtcggtgcccgggcc
catgcatgcccggagtgtggcaaaacgtttgccacttcgtcgggcctcaaacaacacaag
cacatccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcag
ttttcaaacctttgccgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgt
gagggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggccttgct
gactattttggcgccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttccggcttgtaccacaggcctcctttgatacct
gctagttctcctgttaaaggactaccaagtactgaacagacaaacaaaagtcaaagtccc
ctcatgacacatcctcagatactgccagctacacaggatattttgaaggcactatctaaa
cacccatctgtaggggacaataagccagtggagctccagcccgagaggtcctctgaagag
aggccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtaca
ccaagtggcagtgacctggaaacaacctcgggctctgatctggaaagtgacattgaaagt
gataaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccctcttcag
aatctggcttcaataaataataagaaagaatacagcaatcattccattttctcaccatct
ttagaggagcagactgcggtgtcaggagctgtgaatgattctataaaggctattgcttct
attgctgaaaaatactttggttcaacaggactggtggggctgcaagacaaaaaagttgga
gctttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatg
tacccatttcctgatagagacttgagatcgttacctttgaaaatggaaccccaatcacca
ggtgaagtaaagaaactgcagaagggcagctctgagtccccctttgatctcaccactaag
cgaaaggatgagaagcccttgactccagtcccctccaagcctccagtgacgactgccaca
agccaagaccagcccctggatctaagtatgggcagtaggagtagagccagtgggacaaag
ctgactgagcctcgaaaaaaccacgtgtttggggaaaaaaaaggaagcaacatcgaatca
agacctgcttcagatggttccttgcagcatgcaagacccactcctttctttatggaccct
atttacagagtagagaaaagaaaactaactgacccacttgaagctttaaaagagaaatac
ttgaggccttctccaggattcttgtttcacccacaattccaactgcctgatcagagaact
tggatgtcagctattgaaaacatggcagaaaagctagagagcttcagtgccctgaaacct
gaggccagtgagctcttacagtcagtgccctctatgttcaacttcagggcgcctcccaat
gccctgccagagaaccttctgcggaagggaaaggagcgctatacctgcagatactgtggc
aagatttttccaaggtctgcaaacctaacacggcacttgagaacccacacaggagagcag
ccttacagatgcaaatactgtgacagatcatttagcatatcttctaacttgcaaaggcat
gttcgcaacatccacaataaagagaagccatttaagtgtcacttatgtgataggtgtttt
ggtcaacaaaccaatttagacagacacctaaagaaacatgagaatgggaacatgtccggt
acagcaacatcgtcgcctcattctgaactggaaagtacaggtgcgattctggatgacaaa
gaagatgcttacttcacagaaattcgaaatttcattgtgaacagcaaccacggcagccaa
tctcccaggaatgtggaggagagaatgaatggcagtcattttaaagatgaaaaggctttg
gtgaccagtcaaaattcagacttgctggatgatgaagaagttgaagatgaggtgttgtta
gatgaggaggatgaagacaatgatattactggaaaaacaggaaaggaaccagtgacaagt
aatttacatgaaggaaaccctgaggatgactatgaagaaaccagtgccctggagatgagt
tgcaagacatccccagtgaggtataaagaggaagaatataaaagtggactttctgcttta
gatcatataagacacttcacagatagcctcaaaatgaggaaaatggaagataatcaatat
tctgaagctgagctgtcttcttttagtacttcccatgtgccagaggaacttaaacagcca
ttacacagaaagtccaaatcgcaggcgtatgctatgatgctgtcactgtctgacaaggag
tccctccattctacatcccacagttcttccaatgtgtggcacagtatggccagggctgca
gcagaatccagtgctatccagtccataagccacgtatga

KEGG   Pongo abelii (Sumatran orangutan): 100449725
Entry
100449725         CDS       T01416                                 

Gene name
RUNX1
Definition
(RefSeq) LOW QUALITY PROTEIN: runt-related transcription factor 1
  KO
K08367  runt-related transcription factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04530  Tight junction
pon04659  Th17 cell differentiation
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100449725 (RUNX1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100449725 (RUNX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449725 (RUNX1)
   05202 Transcriptional misregulation in cancer
    100449725 (RUNX1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100449725 (RUNX1)
   05220 Chronic myeloid leukemia
    100449725 (RUNX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100449725 (RUNX1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    100449725 (RUNX1)
SSDB
Motif
Pfam: Runt RunxI
Other DBs
NCBI-GeneID: 100449725
NCBI-ProteinID: XP_002830706
Ensembl: ENSPPYG00000011394
LinkDB
Position
21
AA seq 479 aa
MASDSIFESFPSYPQCFMRECILGMNPSRDVHDASTSRRFTPPSTALSPGKMSEALPLGA
PDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVA
LGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVF
TNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVST
PPSPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATP
ISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVT
SGIGIGMSAMGSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGG
ERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcttcagacagcatatttgagtcatttccttcgtacccacagtgcttcatgagagaa
tgcatacttggaatgaatccttctagagacgtccacgatgccagcacgagccgccgcttc
acgccgccttccaccgcgctgagcccaggcaagatgagcgaggcgttgccgctgggcgcc
ccggacgccggtgctgccctggccggcaagctgaggagcggcgaccgcagcatggtggag
gtgctggccgaccacccgggcgagctggtgcgcaccgacagccccaacttcctctgctcc
gtgttgcctacgcactggcgctgcaacaagaccctgcccatcgctttcaaggtggtggcc
ctaggggatgttccagatggcactctggtcactgtgatggccggcaatgatgaaaactac
tcggctgagctgagaaatgctaccgcagccatgaagaaccaggttgcaagatttaatgac
ctcaggtttgtcggtcgaagtggaagagggaaaagcttcactctgaccatcactgtcttc
acaaacccaccgcaagtcgccacctaccacagagccatcaaaatcacagtggatgggccc
cgagaacctcgaagacatcggcagaaactagatgatcagaccaagcccgggagcttgtcc
ttttccgagcggctcagtgaactggagcagctgcggcgcacagccatgagggtcagcaca
ccacccagccccacgcccaaccctcgtgcctccctgaaccactccactgcctttaaccct
cagcctcagagtcagatgcaggatacaaggcagatccaaccatccccaccgtggtcctac
gatcagtcctaccaatacctgggatccattgcctctccttctgtgcacccagcaacgccc
atttcacctggacgtgccagcggcatgacaaccctctctgcagaactttccagtcgactc
tcaacggcacccgacctgacggccttcagcgacccgcgccagttccccgcgctgccctcc
atctccgacccccgcatgcactacccgggcgccttcacctactccccgacgccggtcacc
tcgggcatcggcatcggcatgtcggccatgggctcggccacgcgctaccacacctacctg
ccgccgccctaccccggctcgtcgcaagcgcagggcggcccgttccaagccagctcgccc
tcctaccacctgtactacggcgcctcggccggctcctaccagttctccatggtgggcggc
gagcgctcgccgccgcgcatcctgccgccctgcaccaacgcctccaccggctccgcgctg
ctcaaccccagcctcccgaaccagagcgacgtggtggaggccgagggcagccacagcaac
tcccccaccaacatggcgcccgccgcgcgcctggaggaggccgtgtggaggccctactga

DBGET integrated database retrieval system