KEGG   Pongo abelii (Sumatran orangutan): 100432364
Entry
100432364         CDS       T01416                                 

Gene name
KLK3
Definition
(RefSeq) prostate-specific antigen isoform X1
  KO
K01351  semenogelase [EC:3.4.21.77]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05200  Pathways in cancer
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432364 (KLK3)
  09162 Cancer: specific types
   05215 Prostate cancer
    100432364 (KLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100432364 (KLK3)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.77  semenogelase
     100432364 (KLK3)
Peptidases and inhibitors [BR:pon01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100432364 (KLK3)
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 100432364
NCBI-ProteinID: XP_009231229
LinkDB
Position
19
AA seq 306 aa
MSVPLCFCLFFLILCIFGSPCLSLFSPLSFHSLCPFTLFPFPLVSLSFCICLSPSHTAVS
QLIVCIFGPNCVFPNPVFFLLFLSLFWSLLFAPLSLLSFLIILAPHSCICFLPSKSVILL
GRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAEITDA
VKVMDLPTQEPALGTTCYASGWGSIEPDEFLIPKKLQCVDLHVISNDVCAQVHPQKVTKF
MLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVYYRKWIKD
TIVANP
NT seq 921 nt   +upstreamnt  +downstreamnt
atgtctgttcctctatgtttctgtcttttctttctcatcctgtgtattttcggctcacct
tgtttgtcactgttctcccctctgtcctttcattctctctgtccttttacactctttcct
tttcccttggtttctctcagtttctgtatctgcctttcaccctctcatactgctgtttcc
caactcattgtctgtatttttggcccgaactgtgtcttcccgaaccccgtgtttttcttg
ctgtttctttctctcttttggagcctcctctttgctcctctgtcccttctctctttcctt
atcatccttgctcctcattcctgcatctgcttcctccccagcaaaagcgtgatcttgctg
ggtcggcacagcctgtttcatcctgaagacacaggccaggtatttcaggtcagccacagc
ttcccacacccgctctatgatatgagcctcctgaagaatcgattcctcaggccaggtgat
gactccagccacgacctcatgctgctccgcctgtcagagcctgccgagatcacagatgct
gtgaaggtcatggacctgcccacccaggagccagcactggggaccacctgctacgcctca
ggctggggcagcatcgaaccagacgagttcttgatcccaaagaaacttcagtgtgtggac
ctccatgttatttccaatgatgtgtgtgcgcaagttcaccctcagaaggtgaccaagttc
atgctgtgtgctggacgctggacaggcggcaaaagcacctgctcgggtgattctgggggc
ccacttgtctgtaatggtgtgcttcaaggtatcacgtcatggggcagtgaaccatgtgcc
ctgcccgaaaggccttccctgtacaccaaggtggtgtattaccggaagtggatcaaggac
accatcgtggccaacccctga

DBGET integrated database retrieval system