KEGG   Pongo abelii (Sumatran orangutan): 100432611
Entry
100432611         CDS       T01416                                 

Gene name
ELK1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04510  Focal adhesion
pon04910  Insulin signaling pathway
pon04912  GnRH signaling pathway
pon04921  Oxytocin signaling pathway
pon05140  Leishmaniasis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05213  Endometrial cancer
pon05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100432611 (ELK1)
   04012 ErbB signaling pathway
    100432611 (ELK1)
   04014 Ras signaling pathway
    100432611 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100432611 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100432611 (ELK1)
   04912 GnRH signaling pathway
    100432611 (ELK1)
   04921 Oxytocin signaling pathway
    100432611 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100432611 (ELK1)
   05205 Proteoglycans in cancer
    100432611 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100432611 (ELK1)
   05213 Endometrial cancer
    100432611 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100432611 (ELK1)
   05161 Hepatitis B
    100432611 (ELK1)
   05163 Human cytomegalovirus infection
    100432611 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100432611 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100432611 (ELK1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100432611 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 100432611
NCBI-ProteinID: XP_009233061
Ensembl: ENSPPYG00000020299
UniProt: K7ETA0
LinkDB
Position
X
AA seq 428 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAVH
AAPGDTASGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPNAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRALPPEVKVEGPKEELEVAGERGFVPDTTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctgagagagcaaggcaat
ggccacatcatctcctggacttcacgggatggtggtgaattcaagctggtggatgcagag
gaggtggcccggctgtgggggctacgcaagaacaagaccaacatgaattacgacaagctc
agccgggccttgcggtactactatgacaagaacatcatccgcaaggtgagcggccagaag
ttcgtctacaagtttgtgtcctaccctgaggtcgcagggtgctccactgaggactgcccg
ccccagccagaggtgtctgttacctccaccatgccaaatgtggcccctgctgctgtacat
gccgccccaggagacactgcctctggaaagccaggcacacccaagggtgcaggaatggca
ggcccaggcggtttggcgcgcagcagccggaacgagtacatgcgctcgggcctctattcc
accttcaccatccagtctctgcagccgcagccaccccctcatcctcggcctgctgtggtg
ctccccaatgcagctcctgcaggggcagcagcgcccccctcggggagcaggagcaccagt
ccaagccccttggaggcctgtctggaggctgaagaggccggcttgcctctgcaggtcatc
ctgaccccgcctgaggccccaaacctgaaatcggaagagctgaatgtggagccgggtttg
ggccgagctttgcccccagaagtgaaagtagaagggcccaaggaagagttggaagttgct
ggggagagagggtttgtgccagataccaccaaggccgagccagaagtccctccacaggag
ggcgtgccagcccggctgcccgcggttgttatggacaccgcagggcaggcgggcggccac
gcggcttccagccctgagatctcccagccgcagaagggccggaagccccgggacctagag
cttccactcagcccgagcctgctaggtgggccgggacccgaacggaccccaggatcggga
agtggctccggcctccaggctccggggccggcgctgaccccgtccttgcttcctacgcat
acattgaccccggtgctgctgacacccagctcgctgcctcccagcattcacttctggagc
accctgagtcccattgcgccccgtagcccggccaagctctccttccagtttccatccagt
ggcagcgcccaggtgcacatcccttccatcagcgtggatggcctctcgacccccgtggtg
ctctccccagggccccagaagccatga

DBGET integrated database retrieval system