KEGG   Pongo abelii (Sumatran orangutan): 100434013Help
Entry
100434013         CDS       T01416                                 

Gene name
NEU4
Definition
(RefSeq) sialidase-4 isoform X1
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00511  Other glycan degradation
pon00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100434013 (NEU4)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100434013 (NEU4)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100434013 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 100434013
NCBI-ProteinID: XP_024099242
LinkDB All DBs
Position
2B
AA seq 497 aa AA seqDB search
MMSSAAFPRWPQSMGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPD
DSHAHRLVLRRGTLAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLG
HTPEAVQIATGRNAARLCCVASPDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQL
PSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAA
VDGGKAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPA
PSRPWDDGWSVGPGSSLRPPLLGPGVHEPPEEAAGDPRGGQVPGGPFSRLQPWGDGPRHP
GLRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWT
EPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPAS
PEPPNLGDKPQGCCWPS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctctgcagccttcccgaggtggccgcagagcatgggggtccctcgtacccct
tcacggacagtgctcttcgagcgggagaggacgggcctgacctaccgcgtgccctcgctg
ctccccgtgccccccgggcccaccctgctggcttttgtggagcagcggctcagccctgac
gactcccacgcccaccgcctggtgctgaggaggggcacgctggccgggggctccgtgcgg
tggggcgccctgcacgtgctagggacagcggccctggcggagcaccggtccatgaacccc
tgccctgtgcacgatgctggcacgggcaccgtcttcctcttcttcatcgcggtgctgggc
cacacgcctgaggccgtgcagatcgccacggggaggaacgccgcgcgcctctgctgtgtg
gccagccctgacgccggcctctcgtggggcagtgcccgggacctcactgaggaggccatc
ggtggtgccgtgcaggactgggccacgttcgccgtgggtcccggccacggcgtgcagctg
ccctcaggccgcctgctggtgcccgcctacacctaccgcgtggaccgccgagagtgtttt
ggcaagatctgccggaccagccctcactccttcgccttctacagtgatgaccacggccgc
acctggcgctgcggaggcctcgtgcccaacctgcgctcaggcgagtgccagctggcggcg
gtggacggtgggaaggccggcagcttcctctactgcaacgcccggagtcccctgggcagc
cgcgtgcaggcgctcagcactgacgagggcacctccttcctgcccgcagagcgcgtggct
tccctgcccgagactgcctggggctgccagggcagcatcgtaggcttcccggcccccgcc
cccagcaggccatgggatgacggttggtcagtgggccccgggagttccctccggcctcca
ctcctcggtcctggagtccatgaacccccagaggaggctgctggagacccccgtggaggc
caggtgcctggtgggcccttcagccgtctgcagccttggggggatggccccaggcaccct
ggcctcaggcctggggtcagtggggatgtggggtcctggaccctggcactccccatgccc
tttgctgccccgccccagagccccacgtggctgctgtactcccacccagtggggcgcagg
gctcggctacacatgggtatccgcctgagccagtccccgctggacccgcgcagctggaca
gagccctgggtgatctacgagggccccagcggctactccgacctggcgtccatcgggcca
gcccctgaggggggcctggttttcgcctgcctgtacgagagcggggccaggacctcctat
gatgagatttccttttgtacattctccctgcgtgaggtcctggagaacgtgcccgccagc
cccgagccgcccaaccttggggataagcctcaggggtgctgctggccctcgtga

DBGET integrated database retrieval system