KEGG   Pongo abelii (Sumatran orangutan): 100435177
Entry
100435177         CDS       T01416                                 

Gene name
GRIN1
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 1 isoform X1
  KO
K05208  glutamate receptor ionotropic, NMDA 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04724  Glutamatergic synapse
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05033  Nicotine addiction
pon05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100435177 (GRIN1)
   04015 Rap1 signaling pathway
    100435177 (GRIN1)
   04020 Calcium signaling pathway
    100435177 (GRIN1)
   04024 cAMP signaling pathway
    100435177 (GRIN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100435177 (GRIN1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100435177 (GRIN1)
   04720 Long-term potentiation
    100435177 (GRIN1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100435177 (GRIN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100435177 (GRIN1)
   05014 Amyotrophic lateral sclerosis
    100435177 (GRIN1)
   05016 Huntington disease
    100435177 (GRIN1)
   05017 Spinocerebellar ataxia
    100435177 (GRIN1)
   05020 Prion disease
    100435177 (GRIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100435177 (GRIN1)
  09165 Substance dependence
   05030 Cocaine addiction
    100435177 (GRIN1)
   05031 Amphetamine addiction
    100435177 (GRIN1)
   05033 Nicotine addiction
    100435177 (GRIN1)
   05034 Alcoholism
    100435177 (GRIN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pon04040]
    100435177 (GRIN1)
Ion channels [BR:pon04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100435177 (GRIN1)
SSDB
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 CaM_bdg_C0 Ion_trans_2
Other DBs
NCBI-GeneID: 100435177
NCBI-ProteinID: XP_024108111
Ensembl: ENSPPYG00000019809
LinkDB
Position
9
AA seq 959 aa
MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQFDPGTKNVTALLMEAKELEARVI
ILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVE
FNEDGDRKFANYSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLK
IVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTI
NNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYL
LDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVEL
STMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKAT
FRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
NT seq 2880 nt   +upstreamnt  +downstreamnt
atgagcaccatgcgcctgctgacgctcgccctgctgttctcctgctccgtcgcccgtgcc
gcgtgcgaccccaagatcgtcaacattggcgcggtgctgagcacgcggaagcacgagcag
atgttccgcgaggccgtgaaccaggccaacaagcggcatggctcctggaagattcagctc
aatgccacgtccgtcacgcacaagcccaacgccatccagatggctctgtcggtgtgcgag
gacctcatctccagccaggtctacgccatcctagttagccatccacctacccccaacgac
cacttcactcccacccctgtctcctacacagccggcttctaccgcatccccgtgctgggg
ctgaccacccgcatgtccatctactcggacaagagcatccacctgagcttcctgcgcacc
gtgccgccctactcccaccagtcgagcgtgtggtttgagatgatgcgtgtctacagctgg
aaccacatcatcctgctggtcagcgacgaccacgagggccgggcggctcagaagcgcctg
gagacgctgctggaggagcgtgagtccaagagtaaaaaaaggaactatgaaaacctcgac
caactgtcctatgacaacaagcgcggacccaaggcagagaaggtgctgcagtttgaccca
gggaccaagaacgtgacggccctgctgatggaggcgaaagagctggaggcccgggtcatc
atcctttctgccagcgaggacgatgctgccactgtataccgcgcagccgcgatgctgaac
atgacgggctccgggtacgtgtggctggtcggggagcgcgagatctcggggaacgccctg
cgctacgccccggacggcatcctcgggctgcagctcatcaacggcaagaacgagtcggcc
cacatcagcgacgccgtgggcgtggtggcccaggccgtgcacgagctcctcgagaaggag
aacatcaccgacccgccgcggggctgcgtgggcaacaccaacatctggaagactgggccg
ctcttcaagagagtgctgatgtcttccaagtatgcggacggggtgactggtcgcgtggag
ttcaatgaggatggggaccggaagttcgccaactacagcatcatgaacctgcagaaccgc
aagctggtgcaagtgggcatctacaatggcacccacgtgatccctaatgacaggaagatc
atctggccaggcggagagacagagaagcctcgagggtaccagatgtccaccagactgaag
attgtgacgatccaccaggagcccttcgtgtacgtcaagcccacgctgagtgatgggaca
tgcaaggaggagttcacagtcaacggcgacccagtcaagaaggtgatctgcaccgggccc
aacgacacgtcgccaggcagcccccgccacacggtgcctcagtgttgctacggcttttgc
atcgacctgctcatcaagctggcacggaccatgaacttcacctacgaggtgcacctggtg
gcggatggcaagttcggcacacaggagcgggtgaacaacagcaacaagaaggagtggaat
gggatgatgggcgagctgctcagcgggcaggcagacatgatcgtggcgccgctaaccata
aacaacgagcgcgcgcagtacatcgagttttccaagcccttcaagtaccagggcctgact
attctggtcaagaaggagattccccggagcacgctggactcgttcatgcagccgttccag
agcacactgtggctgctggtggggctgtcggtgcacgtggtggccgtgatgctgtacctg
ctggaccgcttcagccccttcggccggttcaaggtgaacagcgaggaggaggaggaggac
gcactgaccctgtcctcggccatgtggttctcctggggcgtcctgctcaactccggcatc
ggggaaggcgcccccagaagcttctcggcgcgcatcctgggcatggtgtgggccggcttt
gccatgatcatcgtggcctcctacaccgccaacctggcggccttcctggtgctggaccgg
ccggaggagcgcatcacgggcatcaacgaccctcggctgaggaacccctcggacaagttt
atctacgccacggtgaagcagagctccgtggacatctacttccggcgccaggtggagctg
agcaccatgtaccggcatatggagaagcacaactacgagagtgcggcggaggccatccag
gccgtgagagacaacaagctgcatgccttcatctgggactcggcggtgctggagttcgag
gcctcgcagaagtgcgacctggtgacgactggagagctgttcttccgctcgggcttcggt
ataggcatgcgcaaagacagcccctggaagcagaacgtctccctgtccatcctcaagtcc
catgagaatggcttcatggaagacctggacaagacgtgggttcggtatcaggaatgtgac
tcccgcagcaacgcccctgcgacccttacttttgagaacatggcaggggtcttcatgctg
gtagctgggggcatcgtggccgggatcttcttgattttcattgagattgcctacaagcgg
cacaaggatgctcgccggaagcagatgcagctggcctttgcagccgtgaacgtgtggagg
aagaacctgcaggatagaaagagtggtagagcagagcctgaccctaaaaagaaagccaca
tttagggctatcacctccaccctggcttccagcttcaagaggcgtaggtcctccaaagac
acgagcaccgggggtggacgcggcgctttgcaaaaccaaaaagacacagtgctgccgcga
cgcgctattgagagggaggagggccagctgcagctgtgttcccgtcatagggagagctga

KEGG   Pongo abelii (Sumatran orangutan): 100438553
Entry
100438553         CDS       T01416                                 

Gene name
GRIN2A
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2A
  KO
K05209  glutamate receptor ionotropic, NMDA 2A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04724  Glutamatergic synapse
pon04728  Dopaminergic synapse
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05033  Nicotine addiction
pon05034  Alcoholism
pon05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100438553 (GRIN2A)
   04015 Rap1 signaling pathway
    100438553 (GRIN2A)
   04020 Calcium signaling pathway
    100438553 (GRIN2A)
   04024 cAMP signaling pathway
    100438553 (GRIN2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100438553 (GRIN2A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100438553 (GRIN2A)
   04728 Dopaminergic synapse
    100438553 (GRIN2A)
   04720 Long-term potentiation
    100438553 (GRIN2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100438553 (GRIN2A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100438553 (GRIN2A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100438553 (GRIN2A)
   05014 Amyotrophic lateral sclerosis
    100438553 (GRIN2A)
   05017 Spinocerebellar ataxia
    100438553 (GRIN2A)
   05020 Prion disease
    100438553 (GRIN2A)
   05022 Pathways of neurodegeneration - multiple diseases
    100438553 (GRIN2A)
  09165 Substance dependence
   05030 Cocaine addiction
    100438553 (GRIN2A)
   05031 Amphetamine addiction
    100438553 (GRIN2A)
   05033 Nicotine addiction
    100438553 (GRIN2A)
   05034 Alcoholism
    100438553 (GRIN2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pon04040]
    100438553 (GRIN2A)
Ion channels [BR:pon04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100438553 (GRIN2A)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 100438553
NCBI-ProteinID: XP_024089672
Ensembl: ENSPPYG00000007089
LinkDB
Position
16
AA seq 1464 aa
MGRVGYWTLLVLPALLVWRGPAPSAAAEKGPPALNIAVMLGHSHDVTERELRTLWGPEQA
AGLPLDVNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSHT
FVPILGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGY
REFISFVKTTVDNSFVGWDMKNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGIGILT
TAASSMLEKFSYIPEAKASCYGQMERPEVPMHTLHPFMVNVTWDGKDLSFTEEGYQVHPR
LVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLV
TNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRS
NGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFT
IGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVD
QVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSL
KTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALL
QFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRS
AKNISNMSNMNSSRMDSPKRAADFIQRGSLIMDMVSDKGNLMYSDNRSFQGKESIFGDNM
NELQTFVANRQKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKVNSRPRQLWKKSMDS
IRQDSLSQNPVSQRDEGTAENRTHSLKSPRYLPEEMAHSDISETSNRATCHREPDNSKNH
KTKDNFKRSGASKYPKDCSEVERTYLKTKSSSPRDKIYTIDGEKEPGFHLDPPQFVENVT
LPENVDFPDPYQDHSENFRKGDSTLPMNRNPLHNEEGPSNNDQYKLYSKHFTLKDKGSPH
SETSERYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP
ATGEQVYQQDWAQNNALQLQKNKLRISRQHSYDNIVDKPRELDLSRPSRSISLKDRERLL
EGNFYGSLFSVPSSKLSGKKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHSHRDDQRLVIG
RCPSDPYKHSLPSQAVNDSYLRSSLRSTASYCSRDSRGHNDVYISEHVMPYAANKNNMYS
TPRVLNSCSNRRVYKKMPSIESDV
NT seq 4395 nt   +upstreamnt  +downstreamnt
atgggcagagtgggctattggaccctgctggtgctgccggcccttctggtctggcgcggt
ccggcgccgagcgcggcggcggagaagggtccccccgcgctgaatattgcggtgatgctg
ggtcacagccacgacgtgacagagcgcgaacttcgaaccctgtggggccccgagcaggcg
gcggggctgcccctggacgtgaacgtggtagctctgctgatgaaccgcaccgaccccaag
agcctcatcacgcacgtgtgcgacctcatgtccggggcacgcatccacggcctcgtgttt
ggggacgacacggaccaggaggctgtagcccagatgctggattttatctcctcccatacc
ttcgtccccatcttgggcattcatgggggcgcatctatgatcatggctgacaaggatccg
acgtctaccttcttccagtttggagcgtccatccagcagcaagccacggtcatgctgaag
atcatgcaggattatgactggcatgttttctccctggtaaccaccatcttccctggctac
agggaattcatcagcttcgtcaagaccacagtggacaacagctttgtgggctgggacatg
aagaatgtgatcacactggacacttcctttgaggatgcaaagacacaagtccagttgaag
aagatccactcttctgtcatcttgctctactgttccaaagacgaggctgttctcattctg
agtgaggcccgctcccttggcctcaccgggtatgatttcttctggattgtccccagcttg
gtctctgggaacacggagctcatcccaaaagagtttccatcgggactcatttctgtctcc
tacgatgattgggactacagcctggaggcgagagtgagggacggcattggcatcctaacc
accgctgcgtcttctatgctggagaagttctcctacatccccgaggccaaggccagctgc
tacgggcagatggagaggccagaggtcccgatgcacaccttgcacccatttatggtcaat
gttacatgggatggcaaagacttatccttcactgaggaaggctaccaggtgcaccccagg
ctggtggtgattgtgctgaacaaagaccgggaatgggaaaaggtgggcaagtgggagaac
cagacgctgagcctgaggcacgccgtgtggcccaggtacaagtccttctccgactgtgag
cctgatgacaaccatctcagcatcgtcaccctggaggaggccccattcgtcatcgtggaa
gacatagaccccctgaccgagacgtgtgtgaggaacaccgtgccatgtcggaagttcgtc
aaaatcaacaattcaaccaatgaggggatgaatgtgaagaaatgctgcaaggggttctgc
attgatattctgaagaagctttccagaactgtgaagtttacttacgacctctacctggtg
accaatgggaagcatggcaagaaagttaacaatgtgtggaatggaatgatcggtgaagtg
gtctatcaacgggcagtcatggcggttggctcgctcaccatcaatgaggaacgttctgaa
gtggtggacttctctgtgccctttgtggaaacgggaatcagtgtcatggtttcaagaagt
aatggcactgtctcaccttctgcttttctagaaccattcagcgcctctgtctgggtgatg
atgtttgtgatgctgctcattgtttctgccatagctgtttttgtctttgaatacttcagc
cctgttggatacaatagaaacttagccaaagggaaagcaccccatgggccttcttttaca
attggaaaagctatatggcttctttggggcctggtgttcaataactccgtgcctgtccag
aatcctaaagggaccaccagcaagatcatggtatccgtatgggccttcttcgctgtcata
ttcctggctagctacacagccaatctggctgccttcatgatccaagaggaatttgtggac
caagtgactggcctcagtgacaaaaagtttcagagacctcatgactattccccacctttt
cgatttgggacagtgcctaatggaagcacagagagaaacattcggaataactatccctac
atgcatcagtacatgaccaaatttaatcagaagggagtagaggacgccttggtcagcctg
aaaacagggaagctggacgctttcatctacgatgccgcagtcttgaattacaaggccggg
agggatgaaggctgcaagctggtgaccatcgggagtgggtacatctttgccaccaccggt
tacggaattgcccttcagaaaggctctccttggaagaggcagattgacctggccttgctt
cagtttgtgggtgatggtgagatggaggagctggagaccctgtggctcaccgggatctgc
cacaacgagaagaacgaggtgatgagcagccagctggacattgacaacatggcgggcgtg
ttctacatgctggccgccgccatggcccttagcctcatcaccttcatctgggagcacctc
ttctactggaagctgcgcttctgtttcacgggcgtgtgctccgaccggcctgggttgctc
ttctccatcagcaggggcatctacagctgcattcatggagtgcacattgaagaaaagaag
aagtctccagacttcaatctgacgggatcccagagcaacatgttaaaactcctccggtca
gccaaaaacatttccaacatgtccaacatgaactcctcaagaatggactcacccaaaaga
gctgctgacttcatccaaagaggttccctcatcatggacatggtttcagataaggggaat
ttgatgtactcagacaacaggtcctttcaggggaaagagagcatttttggagacaacatg
aacgaactccaaacatttgtggccaaccggcagaaggataacctcaataactatgtattc
cagggacaacatcctcttactctcaatgagtccaaccctaacacggtggaggtggccgtg
agcacagaatccaaagtgaactctagaccccggcagctttggaagaaatccatggattcc
atacgccaggattcactatcccagaatccagtctcccagagggatgagggaacagcagag
aataggacccactccctaaagagccctaggtatcttccagaagagatggcccattctgac
atttcagaaacgtcaaatcgggccacgtgccacagggaacctgacaacagtaagaaccac
aaaaccaaggacaactttaaaaggtcaggggcctccaaataccccaaggactgtagtgag
gtcgagcgcacctacctgaaaaccaaatcaagctcccccagagacaagatctacactatt
gatggtgagaaggagcctggtttccacttagatccaccccagtttgttgaaaacgtgacc
ctgcccgagaacgtggacttcccagacccctaccaggatcacagtgaaaacttccgcaag
ggggactccacgctgccaatgaaccggaaccccttgcataatgaagaggggccttccaac
aacgaccagtataaactctactccaagcacttcaccttgaaagacaagggttccccgcac
agtgagaccagcgagcgataccggcagaactccacacactgcagaagctgcctttccaac
ctgcccacctattcaggccacttcaccatgaggtcccccttcaagtgcgatgcctgcctg
cggatggggaacctctatgacatcgatgaagaccagatgcttcaggagacaggtaaccca
gccaccggggagcaggtctaccagcaggactgggcacagaacaatgcccttcaattacaa
aagaacaagctaaggattagccgtcagcattcctacgataacattgtcgacaaacctagg
gagctagaccttagcaggccctcccggagcataagcctcaaggacagggaacggcttctg
gagggaaatttttacggcagcctgtttagtgtcccctcaagcaaactctcggggaaaaaa
agctcccttttcccccaaggtctggaggacagcaagaggagcaagtctctcttgccagac
cacacctccgataaccctttcctccactcccacagggatgaccaacgcttggttattggg
agatgcccctcggacccttacaaacactcgttgccatcccaggcggtgaatgacagctat
cttcggtcgtccttgaggtcaacggcatcgtactgttccagggacagtcggggccacaat
gatgtgtatatttcggagcatgttatgccttatgctgcaaataagaataatatgtactct
acccccagggttttaaattcctgcagcaatagacgcgtgtacaagaaaatgcctagtatc
gaatctgatgtttaa

KEGG   Pongo abelii (Sumatran orangutan): 100458706
Entry
100458706         CDS       T01416                                 

Gene name
GRIN2B
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2B
  KO
K05210  glutamate receptor ionotropic, NMDA 2B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04724  Glutamatergic synapse
pon04728  Dopaminergic synapse
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05033  Nicotine addiction
pon05034  Alcoholism
pon05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100458706 (GRIN2B)
   04015 Rap1 signaling pathway
    100458706 (GRIN2B)
   04024 cAMP signaling pathway
    100458706 (GRIN2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100458706 (GRIN2B)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100458706 (GRIN2B)
   04728 Dopaminergic synapse
    100458706 (GRIN2B)
   04720 Long-term potentiation
    100458706 (GRIN2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100458706 (GRIN2B)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100458706 (GRIN2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100458706 (GRIN2B)
   05014 Amyotrophic lateral sclerosis
    100458706 (GRIN2B)
   05016 Huntington disease
    100458706 (GRIN2B)
   05017 Spinocerebellar ataxia
    100458706 (GRIN2B)
   05020 Prion disease
    100458706 (GRIN2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100458706 (GRIN2B)
  09165 Substance dependence
   05030 Cocaine addiction
    100458706 (GRIN2B)
   05031 Amphetamine addiction
    100458706 (GRIN2B)
   05033 Nicotine addiction
    100458706 (GRIN2B)
   05034 Alcoholism
    100458706 (GRIN2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pon04040]
    100458706 (GRIN2B)
Ion channels [BR:pon04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100458706 (GRIN2B)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 100458706
NCBI-ProteinID: XP_002823014
Ensembl: ENSPPYG00000004317
UniProt: H2NGN9
LinkDB
Position
12
AA seq 1484 aa
MKPRAECCSPKFWLVLAVLAVSGSRARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPAEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIVTENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAI
LQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEH
LFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILR
LLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFS
DYISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSASSIDGLYDCDNPPFTTQSRSISK
KPLDIGLPSSKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKR
RKQQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTK
ENSPHWEHVDLTDIYKERSDDFKRDSVSGGGPCTNRSHIKHGTGDKHGVVSGVPAPWEKN
LTNVEWEDRSGGNFCRSCPSKLHNYSTTVTGQNSGRQACIRCEACKKAGNLYDISEDNSL
QELDQPAAPVAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPR
SVSLKDKGRFMDGSPYAHMFEMSAGESTFANNKSSVPTAGHHHHNNPGSGYMLSKSLYPD
RVTQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGASKARPDFRALVTNKPVVSALHGAVPA
RFQKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
NT seq 4455 nt   +upstreamnt  +downstreamnt
atgaagcccagagcggagtgctgttctcccaagttctggttggtgttggccgtcctggcc
gtgtcaggcagcagagctcgttctcagaagagcccccccagcattggcattgctgtcatc
ctcgtgggcacttccgacgaggtggccatcaaggatgcccacgagaaagatgatttccac
catctctccgtggtgccccgggtggaactggtagccatgaatgagaccgacccaaagagc
atcatcacccgcatctgtgatctcatgtctgaccggaagatccagggggtggtgtttgct
gatgacactgaccaggaagccatcgcccagatcctcgatttcatttcagcacagactctc
acccccatcctgggcatccacgggggctcctctatgataatggcagataaggatgaatcc
tccatgttcttccagtttggcccatcaattgaacagcaagcttccgtaatgctcaacatc
atggaagaatatgactggtacatcttttctatcgtcaccacctatttccctggctaccag
gactttgtaaacaagatccgcagcaccattgagaatagctttgtgggctgggagctagag
gaagtcctcctactggacatgtccctggacgatggagattctaagatccagaatcagctc
aagaaacttcaaagccccatcattcttctttactgtaccaaggaagaagccacctacatc
tttgaagtggccaactcagtagggctgactggctacggctacacgtggatcgtgcccagt
ctggtggcaggggatacagacacagtgcctgcggagttccccactgggctcatctctgta
tcatatgatgaatgggactatggcctccctgccagagtgagagatggaattgccataatc
accactgctgcttctgacatgctgtccgagcacagcttcatccctgagcccaaaagcagt
tgttacaacacccatgagaagagaatctaccagtccaatatgctaaataggtatctgatc
aacgtcacttttgaggggaggaatttgtccttcagtgaagatggttaccagatgcacccg
aaactggtgataattcttctgaacaaggagaggaagtgggaaagggtggggaagtggaaa
gacaagtccctgcagatgaagtactatgtgtggccccgaatgtgtccagagactgaagag
caggaggatgaccatctgagcattgtgaccctggaggaggcaccatttgtcattgtggaa
agtgtggaccctctgagtggaacctgcatgaggaacacagtcccctgccaaaaacgcata
gtcactgagaataaaacagacgaggagccgggttacatcaaaaaatgctgcaaggggttc
tgtatcgacatccttaagaaaatttctaaatctgtgaagttcacctatgacctttacctg
gttaccaatggcaagcatgggaagaaaatcaatggaacctggaatggtatgattggagag
gtggtcatgaaaagggcctacatggcggtgggctcgctcaccatcaatgaggaacgatcg
gaggtggtcgacttctctgtgcccttcatagagacaggcatcagtgtcatggtgtcacgc
agcaatgggactgtctcaccttctgccttcttagagccattcagtgctgacgtatgggtg
atgatgtttgtgatgctgctcatcgtctcagccgtggctgtctttgtctttgagtacttc
agccctgtgggttataacaggtgcctcgctgatggcagagagcctggtggcccctctttc
accatcggcaaagctatttggttgctctggggtctggtgtttaacaactccgtacctgtg
cagaacccaaaggggaccacctccaagatcatggtgtcagtgtgggccttctttgctgtc
atcttcctggccagctacactgccaacttagctgccttcatgatccaagaggaatatgtg
gaccaggtttctggcctgagcgacaaaaagttccagagacctaatgacttctcaccccct
ttccgctttgggaccgtgcccaacggcagcacagagagaaatattcgcaataactatgca
gaaatgcatgcctacatgggaaagttcaaccagaggggtgtagatgatgcattgctctcc
ctgaaaacagggaaactggatgccttcatctatgatgcagcagtgctgaactatatggca
ggcagagatgaaggctgcaagctggtgaccattggcagtgggaaggtctttgcttccact
ggctatggcattgccatccaaaaagattctgggtggaagcgccaggtggaccttgctatc
ctgcagctctttggagatggggagatggaagaactggaagctctctggctcactggcatt
tgtcacaatgagaagaatgaggtcatgagcagccagctggacattgacaacatggcaggg
gtcttctacatgttgggggcggccatggctctcagcctcatcaccttcatctgcgaacac
cttttctattggcagttccgacattgctttatgggtgtctgttctggcaagcctggcatg
gtcttctccatcagcagaggtatctacagctgcatccatggggtggcgatcgaggagcgc
caatctgtaatgaactcccccaccgcaaccatgaacaacacacactccaacatcctgcgc
ctgctgcgcacggccaagaacatggctaacctgtctggtgtgaacggctccccgcagagc
gccctggacttcatccgacgggagtcatccgtctatgacatctcagagcaccgccgcagc
ttcacgcattctgactgcaaatcctacaacaacccgccctgtgaggagaacctcttcagt
gactacatcagtgaggtagagagaacattcgggaacctgcagctgaaggacagcaacgtg
taccaagatcactaccaccatcaccaccggccccatagcattggcagtgccagctccatc
gatgggctctacgactgtgacaacccacccttcaccacccagtccaggtccatcagcaag
aagcccctggacatcggcctcccctcctccaagcacagccagctcagtgacctgtacggc
aaattctccttcaagagcgaccgctacagtggccacgacgacttgatccgctctgatgtc
tctgacatctcaacccacaccgtcacctatgggaacatcgagggcaatgccgccaagagg
cgtaagcagcaatataaggacagcctgaagaagcggcctgcctcagccaagtcccgcagg
gagtttgacgagatcgagctggcctaccgtcgccgaccgccccgctcccctgaccacaag
cgctacttcagggacaaggaagggctacgggacttctacctggaccagttccgcacaaag
gagaactcaccccactgggagcacgtggacctgaccgacatctacaaggagcggagtgat
gactttaagcgcgactccgtcagcggaggagggccctgtaccaacaggtctcacatcaag
cacgggacgggcgacaaacacggcgtggtcagcggggtacctgcaccttgggagaagaac
ctgaccaacgtggagtgggaggaccggtccgggggcaacttctgccgcagctgtccctcc
aagctgcacaactactccacgacggtgacgggtcagaactcgggcaggcaggcgtgcatc
cggtgtgaggcttgcaagaaagcaggcaacctgtatgacatcagcgaggacaactccctg
caggaactggaccagccggctgccccagtggcggtgacgtcaaacgcctccaccactaag
taccctcagagcccgactaattccaaggcccagaagaagaaccggaacaaactgcgccgg
cagcactcctacgacaccttcgtggacctgcagaaggaagaagccgccctggccccgcgc
agcgtaagcctgaaagacaagggccgattcatggatgggagcccctacgcccacatgttt
gagatgtcagctggcgagagcacctttgccaacaacaagtcctcagtgcccactgccgga
catcaccaccacaacaaccccggcagcggctacatgctcagcaagtcgctctaccctgac
cgggtcacgcaaaaccctttcatccccacttttggggacgaccagtgcttgctccatggc
agcaaatcctacttcttcaggcagcccacggtggcgggggcgtcgaaagccaggccggac
ttccgggcccttgtcaccaacaagccagtggtctcggcccttcatggggccgtgccagcc
cgtttccagaaggacatctgtatagggaaccagtccaacccctgtgtgcctaacaacaaa
aaccccagggctttcaatggctccagcaatgggcatgtttatgagaaactttctagtatt
gagtctgatgtctga

DBGET integrated database retrieval system