KEGG   Pongo abelii (Sumatran orangutan): 100435481
Entry
100435481         CDS       T01416                                 

Gene name
SLC7A14
Definition
(RefSeq) probable cationic amino acid transporter
  KO
K13871  solute carrier family 7 (cationic amino acid transporter), member 14
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100435481 (SLC7A14)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100435481 (SLC7A14)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100435481 (SLC7A14)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100435481 (SLC7A14)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Other DBs
NCBI-GeneID: 100435481
NCBI-ProteinID: XP_002814319
Ensembl: ENSPPYG00000014293
UniProt: A0A6D2XRL3 H2PBZ7
LinkDB
Position
3
AA seq 771 aa
MSGFFTSLDPRRVQWGAAWYAMHSRILRTKPVESMLEGTGATTAHGTKLAQVLTTVDLIS
LGVGSCVGTGMYVVSGLVAKEMAGPGVIVSFIIAAVASILSGVCYAEFGVRVPKTTGSAY
TYSYVTVGEFVAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL
GKGEESYPDLLALLIAVIVTIIVALGVKNSVGFNNVLNVLNLAVWVFIMIAGLFFINGKY
WAEGQFLPHGWSGVLQGAATCFYAFIGFDIIATTGEEAKNPNTSIPYAITASLVICLTAY
VSVSVILTLMVPYYAIDTESPLMEMFVAHGFYAAKFVVAIGSVAGLTVSLLGSLFPMPRV
IYAMAGDGLLFRFLAHVSSYTETPVVACIVSGFLAALLALLVSLRDLIEMMSIGTLLAYT
LVSVCVLLLRYQPESDIDGFVKFLSEEHTKKKEGILADCEKEACSPVSEGDEFSGPATNT
CGAKNLPSLGDNEMLIGKSDKSTYNVNHPNYGTVDMTTGIEADESENIYLIKLKKLIGPH
YYTMRIRLGLPGKMDRPTAATGHTVTICVLLLFILMFIFCSFIIFGSDYISEQSWWAILL
VVLMVLLISTLVFVILQQPENPKKLPYMAPCLPFVPAFAMLVNIYLMLKLSTITWIRFAV
WCFVGLLIYFGYGIWNSTLEISAREEALHQSTYQRYDVDDPFSVEEGFSYATEGESQEDW
GGPTEDKGFYYQQMSDAKANSRTSSKAKSKSKHKQNSEALIANDELDYSPE
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgagtggcttcttcacctcgctggatccccggcgggtgcagtggggggctgcctggtat
gcaatgcactccaggatcctacgcaccaaaccagtggagtccatgctagagggaactggg
gccaccacggcacatggaactaagctagcccaggtactcaccacagtggacctcatctct
cttggcgttggcagctgtgtgggcactggcatgtatgtggtctctggcctggtggccaag
gaaatggcaggacctggtgtcattgtgtccttcatcattgcagccgtcgcatccatatta
tcaggcgtctgctatgcagagtttggagttcgagtccccaagaccacaggatctgcctac
acctacagctatgtcactgtcggggaatttgtggcatttttcattggctggaacctgatc
ctggagtacctgattggcactgcggccggagccagtgctctgagcagcatgtttgactca
ctagccaaccacaccatcagccgctggatggcggacagcgtgggaaccctcaatggcctg
gggaaaggtgaagaatcatacccagaccttctggctctgttgattgcggtcatcgtgacc
atcattgttgctctgggggtgaagaattccgtaggcttcaacaatgttctcaatgtgctg
aacctggcagtgtgggtgttcatcatgatcgcaggcctcttcttcatcaatgggaaatac
tgggcggagggccagttcttgccccacggctggtcaggggtgctgcaaggagcggcaaca
tgcttctacgctttcattggctttgacatcatcgccaccactggagaggaagccaagaat
cccaacacgtccatcccttatgctatcactgcctccctggtcatctgcctgacagcatat
gtgtctgtgagcgtgatcttaactctgatggtgccatattatgccattgacacggaatcc
ccactcatggagatgtttgtggctcatggcttctatgctgccaaattcgtagtggccatt
gggtctgttgcaggactgacagtcagcttgctggggtccctctttccgatgccgagggtc
atttatgccatggctggtgacgggctccttttcaggttcctggctcacgtcagctcctac
acagagacgccagtggtggcctgcatcgtgtcggggttcctggcagcactcctcgcgctg
ttggtcagcttgagagatctgatagagatgatgtctatcggcacgctcctggcctacacc
ttggtctctgtctgtgtcttgctccttcgataccaacctgagagtgacattgatggtttt
gtcaagttcttgtctgaggagcacaccaagaagaaggaaggcattctggctgactgtgag
aaggaagcttgttctcctgtgagtgaaggggatgaattttctggcccagccaccaacaca
tgtggggccaagaacttaccatccttgggagacaatgagatgctcatagggaaatcagac
aagtcaacctacaacgtcaaccaccccaattacggcaccgtggacatgactacaggcata
gaagctgatgaatccgaaaatatttatctcatcaagttaaagaagctgatcgggcctcat
tattacaccatgagaatccggctgggccttccaggcaaaatggaccggcccacagcagcg
acggggcacacggtgaccatctgcgtgctcctgctcttcatcctcatgttcatcttctgc
tccttcatcatctttggttctgactacatctcagagcagagctggtgggccatccttctg
gttgttctgatggtgctgctgatcagcaccctggtgtttgtgatcctgcagcagccagag
aaccccaagaagctgccctacatggccccttgcctcccctttgtgcctgcctttgccatg
ctggtgaacatctatctcatgctaaagctctccaccatcacatggatccggtttgcggtc
tggtgctttgtgggtctgctgatttattttggatatggcatctggaacagcaccctggaa
atcagcgctcgagaagaggccctgcaccaaagcacgtaccaacgctacgacgtggatgac
cccttctcagtggaggagggtttctcctacgccacagagggcgagagccaggaggactgg
ggcgggcccaccgaagacaaaggcttctattaccaacagatgtcagatgcgaaggcaaac
agccggacaagtagcaaagcgaagagcaaaagcaaacacaaacagaactcagaggccctg
attgcaaatgatgagttagattactctccagagtag

DBGET integrated database retrieval system