KEGG   Pongo abelii (Sumatran orangutan): 100436466
Entry
100436466         CDS       T01416                                 

Gene name
SPINT1
Definition
(RefSeq) kunitz-type protease inhibitor 1 isoform X1
  KO
K15619  Kunitz-type protease inhibitor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05202  Transcriptional misregulation in cancer
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100436466 (SPINT1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100436466 (SPINT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100436466 (SPINT1)
Peptidases and inhibitors [BR:pon01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   100436466 (SPINT1)
SSDB
Motif
Pfam: Kunitz_BPTI MANEC Ldl_recept_a Chordopox_A13L
Other DBs
NCBI-GeneID: 100436466
NCBI-ProteinID: XP_024088488
Ensembl: ENSPPYG00000006364
LinkDB
Position
15
AA seq 531 aa
MAPARTMARARLAPARIPAVALWLLCALGLQGTQAGPPPAPSGLPAGADCLNRFTAGVPA
FVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLIN
CLYEQNFVCKFAPREGFINYLTREVYRSYRQLQTQGFGGSGIPKAWAGIDLKVQPQEPLV
LKDVENTDWRLLRGDTDVRVERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTV
LSTKQTEDYCLASNKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILAC
RGVQGGPLRGSSGAQATFPQGPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNC
PDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFT
YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRRESPLPSTGSVEVGVAVFLVICIVVVV
AILGYCFFKNQRKDFRGHHHCHHPPPTPASSTVSTTEDTEHLVYNHTTRPL
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggcccctgcgaggacgatggcccgcgcccgcctcgccccggcccgcatccctgcagtc
gccttgtggcttctgtgcgcgctcggcctccagggcacccaggccgggccaccgcccgcg
ccctctgggctgcccgcgggagccgactgcctgaaccgctttaccgccggggtgcctgcc
ttcgtgctggacaccaacgcctcggtcagcaacggagccaccttcctggagtcccccacc
gtgcgccggggctgggactgcgtgcgcgcctgctgcaccacccagaactgcaacttggcg
ctagtggagctgcagcccgaccgcggggaggacgccatcgccgcctgcttcctcatcaac
tgcctctacgagcagaacttcgtgtgcaagttcgcgcccagggagggcttcatcaactac
ctcacgagggaagtgtaccgctcctaccgccagctgcagacccagggctttggagggtct
gggatccccaaggcctgggcaggcatagacttgaaggtacaaccccaggaacccctggtg
ctgaaggatgtggaaaacacagattggcgtctactgcggggtgacacggatgtcagggta
gagaggaaagacccaaaccaggtggaactgtggggactcaaggaaggcacctacctgttc
cagctgacagtgactagctcagaccacccagaggacacagccaacgtcacagtcactgtg
ctgtccaccaagcagacagaagactactgcctcgcatccaacaaggtgggccgctgccgg
ggctctttcccacgctggtactatgatcccacggagcagatctgcaagagtttcgtttat
ggaggctgcttgggcaacaagaacaactaccttcgggaagaagagtgcattctagcctgt
cggggtgtgcaaggtgggcctttgagaggcagctctggggctcaggcgactttcccccag
ggcccctccatggaaaggcgccatccagtgtgctctggcacctgtcagcccacccagttc
cgctgcagcaatggctgctgcatcgacagtttcctggagtgtgacgacacccccaactgc
cccgacgcctccgatgaggctgcctgtgaaaaatacacgagtggctttgacgagctccag
cgcatccattttcccagtgacaaagggcactgtgtggacctgccagacacaggactctgc
aaggagagcatcccgcgctggtactacaaccccttcagcgaacactgcgcccgctttacc
tatggtggttgttatggcaacaagaacaactttgaggaagagcagcagtgcctcgagtct
tgtcgcggcatctccaagaaggatgtgtttggcctgaggcgggaaagcccccttcccagc
acaggctctgtggaggtgggtgtcgcagtgttcctggtcatctgcattgtggtggtggta
gccatcctgggttactgcttcttcaagaaccagagaaaggacttccgcggacaccaccac
tgccaccacccaccacccacccctgccagctccactgtctccactaccgaggacacggag
cacctggtgtataaccacaccacccggcccctctga

DBGET integrated database retrieval system