KEGG   Pongo abelii (Sumatran orangutan): 100436566Help
Entry
100436566         CDS       T01416                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00590  Arachidonic acid metabolism
pon01100  Metabolic pathways
pon04064  NF-kappa B signaling pathway
pon04370  VEGF signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04668  TNF signaling pathway
pon04723  Retrograde endocannabinoid signaling
pon04726  Serotonergic synapse
pon04913  Ovarian steroidogenesis
pon04921  Oxytocin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon05140  Leishmaniasis
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05204  Chemical carcinogenesis
pon05206  MicroRNAs in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100436566 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100436566 (PTGS2)
   04064 NF-kappa B signaling pathway
    100436566 (PTGS2)
   04668 TNF signaling pathway
    100436566 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100436566 (PTGS2)
   04657 IL-17 signaling pathway
    100436566 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100436566 (PTGS2)
   04913 Ovarian Steroidogenesis
    100436566 (PTGS2)
   04921 Oxytocin signaling pathway
    100436566 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    100436566 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100436566 (PTGS2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    100436566 (PTGS2)
   05206 MicroRNAs in cancer
    100436566 (PTGS2)
   05204 Chemical carcinogenesis
    100436566 (PTGS2)
   05222 Small cell lung cancer
    100436566 (PTGS2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    100436566 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100436566 (PTGS2)
   05165 Human papillomavirus infection
    100436566 (PTGS2)
   05140 Leishmaniasis
    100436566 (PTGS2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100436566 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 100436566
NCBI-ProteinID: XP_002809734
Ensembl: ENSPPYG00000000408
UniProt: H2N4D1
LinkDB All DBs
Position
1
AA seq 604 aa AA seqDB search
MLARALLLCAVLALSHAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKSDHKRGPAFTNGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAMELYPGLLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcggtcctggcgctcagccatgcagcaaatcct
tgctgttcccacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtat
aagtgcgattgtacccggacaggattctatggagaaaactgctcaacaccggaatttctg
acaagaataaaattatttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgctgactac
ggctacaaaagctgggaagccttctctaacctctcctattataccagagcccttcctcct
gtgcctgatgactgcccgactcccttgggtgtcaaaggtaaaaagcagcttcctgattca
aatgagattgtggaaaaatttcttctaagaagaaagttcatccctgatccccagggcaca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagtcagatcat
aagcgagggccagctttcaccaacgggctgggccatggggtggacttaaatcacatttac
ggtgaaactctggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatacgcaggcagagatgatc
taccctcctcaagtccctgagcatctacggtttgctgtggggcaggaggtctttggtcta
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtatgcgat
gtgcttaaacaggagcatcctgaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtgcaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgagtttaacaccctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatatta
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacaaaaagtatcacaggcttctattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagcct
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctatggagctgtatcctggccttctggtagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagcttatcaaaacagtcaccatcaat
gcaagttcttcccgctccggactagatgatatcaatcccacagtactactcaaagaacgt
tcgactgaactgtag

DBGET integrated database retrieval system