KEGG   Pongo abelii (Sumatran orangutan): 100436665
Entry
100436665         CDS       T01416                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04064  NF-kappa B signaling pathway
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04218  Cellular senescence
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100436665 (GADD45G)
   04064 NF-kappa B signaling pathway
    100436665 (GADD45G)
   04068 FoxO signaling pathway
    100436665 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100436665 (GADD45G)
   04210 Apoptosis
    100436665 (GADD45G)
   04115 p53 signaling pathway
    100436665 (GADD45G)
   04218 Cellular senescence
    100436665 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436665 (GADD45G)
   05202 Transcriptional misregulation in cancer
    100436665 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100436665 (GADD45G)
   05212 Pancreatic cancer
    100436665 (GADD45G)
   05225 Hepatocellular carcinoma
    100436665 (GADD45G)
   05226 Gastric cancer
    100436665 (GADD45G)
   05214 Glioma
    100436665 (GADD45G)
   05216 Thyroid cancer
    100436665 (GADD45G)
   05220 Chronic myeloid leukemia
    100436665 (GADD45G)
   05217 Basal cell carcinoma
    100436665 (GADD45G)
   05218 Melanoma
    100436665 (GADD45G)
   05213 Endometrial cancer
    100436665 (GADD45G)
   05224 Breast cancer
    100436665 (GADD45G)
   05222 Small cell lung cancer
    100436665 (GADD45G)
   05223 Non-small cell lung cancer
    100436665 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100436665 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100436665 (GADD45G)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100436665 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100436665 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100436665
NCBI-ProteinID: XP_002819990
Ensembl: ENSPPYG00000019362
UniProt: H2PSM5 A0A663DIN7
LinkDB
Position
9
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcag
ggtgccgggaaagcgctgcacgagttgctgctgtccgcgcagcgtcagggctgcctcact
gccggcgtctacgagtcagccaaagtcctgaacgtggaccccgacaatgtgaccttctgt
gtgctggctgcggatgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

KEGG   Pongo abelii (Sumatran orangutan): 100452809
Entry
100452809         CDS       T01416                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04064  NF-kappa B signaling pathway
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04218  Cellular senescence
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100452809 (GADD45B)
   04064 NF-kappa B signaling pathway
    100452809 (GADD45B)
   04068 FoxO signaling pathway
    100452809 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100452809 (GADD45B)
   04210 Apoptosis
    100452809 (GADD45B)
   04115 p53 signaling pathway
    100452809 (GADD45B)
   04218 Cellular senescence
    100452809 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452809 (GADD45B)
   05202 Transcriptional misregulation in cancer
    100452809 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100452809 (GADD45B)
   05212 Pancreatic cancer
    100452809 (GADD45B)
   05225 Hepatocellular carcinoma
    100452809 (GADD45B)
   05226 Gastric cancer
    100452809 (GADD45B)
   05214 Glioma
    100452809 (GADD45B)
   05216 Thyroid cancer
    100452809 (GADD45B)
   05220 Chronic myeloid leukemia
    100452809 (GADD45B)
   05217 Basal cell carcinoma
    100452809 (GADD45B)
   05218 Melanoma
    100452809 (GADD45B)
   05213 Endometrial cancer
    100452809 (GADD45B)
   05224 Breast cancer
    100452809 (GADD45B)
   05222 Small cell lung cancer
    100452809 (GADD45B)
   05223 Non-small cell lung cancer
    100452809 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100452809 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100452809 (GADD45B)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100452809 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100452809 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100452809
NCBI-ProteinID: XP_024093110
Ensembl: ENSPPYG00000009354
LinkDB
Position
19
AA seq 160 aa
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTSEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagcttttggtggccgctcagcgccaggatcgcctcacagtgggggtg
tacgagtcggccaagttgatgaatgtggacccagacagcgtggtcctctgcctcttggcc
attgacgaagaggaggaggatgacatcgccctgcaaatccacttcacgctcatccagtct
ttctgctgtgacaacgacatcaacatcgtgcgggtgtcgggcatgcagcgcctggcgcag
ctcctgggagagccggccgagacccagggcacctccgaggcccgagacctgcattgtctc
ctggtcacgaaccctcacaccgacgcctggaagagccacggcttggtggaggtagccagc
tactgcgaagaaagccggggcaacaaccagtgggtcccctacatctctcttcaggaacgc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100456437
Entry
100456437         CDS       T01416                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04064  NF-kappa B signaling pathway
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04218  Cellular senescence
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100456437 (GADD45A)
   04064 NF-kappa B signaling pathway
    100456437 (GADD45A)
   04068 FoxO signaling pathway
    100456437 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100456437 (GADD45A)
   04210 Apoptosis
    100456437 (GADD45A)
   04115 p53 signaling pathway
    100456437 (GADD45A)
   04218 Cellular senescence
    100456437 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100456437 (GADD45A)
   05202 Transcriptional misregulation in cancer
    100456437 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100456437 (GADD45A)
   05212 Pancreatic cancer
    100456437 (GADD45A)
   05225 Hepatocellular carcinoma
    100456437 (GADD45A)
   05226 Gastric cancer
    100456437 (GADD45A)
   05214 Glioma
    100456437 (GADD45A)
   05216 Thyroid cancer
    100456437 (GADD45A)
   05220 Chronic myeloid leukemia
    100456437 (GADD45A)
   05217 Basal cell carcinoma
    100456437 (GADD45A)
   05218 Melanoma
    100456437 (GADD45A)
   05213 Endometrial cancer
    100456437 (GADD45A)
   05224 Breast cancer
    100456437 (GADD45A)
   05222 Small cell lung cancer
    100456437 (GADD45A)
   05223 Non-small cell lung cancer
    100456437 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100456437 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100456437 (GADD45A)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100456437 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100456437 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100456437
NCBI-ProteinID: XP_002810761
Ensembl: ENSPPYG00000001254
UniProt: A0A6D2WXC4 H2N736
LinkDB
Position
1
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctggaggaagtgctcagcaaagccctgagtcagcgcacgatcactgtcggggtg
tacgaagcggccaagctgctcaacgtcgatcccgataacgtggtgttgtgcctgctggcg
gcggacgaggacgacgacagagatgtggctttgcagatccacttcaccctgatccaggcg
ttttgctgcgagaacgacatcaacatcctgcgcgtcagcaacccaggccggttggcggag
ctcctactcttggagaccgacgctggccccgcggcgagcgagggcgccgagcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcatctcaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

DBGET integrated database retrieval system