KEGG   Pongo abelii (Sumatran orangutan): 100437110
Entry
100437110         CDS       T01416                                 

Gene name
KIT
Definition
(RefSeq) mast/stem cell growth factor receptor Kit isoform X1
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04640  Hematopoietic cell lineage
pon04916  Melanogenesis
pon05200  Pathways in cancer
pon05221  Acute myeloid leukemia
pon05224  Breast cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100437110 (KIT)
   04014 Ras signaling pathway
    100437110 (KIT)
   04015 Rap1 signaling pathway
    100437110 (KIT)
   04072 Phospholipase D signaling pathway
    100437110 (KIT)
   04151 PI3K-Akt signaling pathway
    100437110 (KIT)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100437110 (KIT)
  09152 Endocrine system
   04916 Melanogenesis
    100437110 (KIT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437110 (KIT)
   05230 Central carbon metabolism in cancer
    100437110 (KIT)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100437110 (KIT)
   05224 Breast cancer
    100437110 (KIT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100437110 (KIT)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100437110 (KIT)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100437110 (KIT)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100437110 (KIT)
CD molecules [BR:pon04090]
 Proteins
  100437110 (KIT)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 Ig_6 Ig_4 V-set Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100437110
NCBI-ProteinID: XP_024102193
LinkDB
Position
4
AA seq 977 aa
MRGARGAWDFLCVLLLLLRVQTGSSQPSASPGEPSPPSIHPAKSELIVRVGDEIRLLCTD
TGFVKWTFEILDEMNENKQNEWITEKAEATNTGKYTCTNKHGLSSSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFVPDPKAGIMIKSVKRAYH
RLCLHCSADQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSA
NVTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPRPEHQHWIYMNRTFTDKW
EDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNASIAFNVYVNTKPEILTYD
RLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSVD
SSAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCII
VMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGA
FGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGA
CTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTN
EYMDMKPGVSYVVPTKADKRRSARIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKG
MAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPE
SIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEM
YDIMKTCWDVDPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINS
VGSTASSSQPLLVHDDV
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggattttctctgcgttctgctcctactgcttcgcgtc
cagacaggctcttctcaaccatctgcgagtccaggggaaccgtctccaccatccatccat
ccagcaaaatcagagttaatagtccgcgtgggcgatgagattaggctgttatgcactgat
acgggctttgtcaaatggacttttgagatcctcgatgaaatgaatgagaataagcagaat
gaatggatcacagaaaaggcagaagccaccaacaccggcaaatacacctgcaccaacaaa
cacggcttaagcagttccatttatgtgtttgttagagatcctgccaagcttttccttgtt
gaccgctccttgtatgggaaagaagacaacgacacgctggtccgctgtcctctcacagac
ccagaagtgaccaattattccctcaaggggtgccaggggaagcctcttcccaaggacttg
aggtttgttcctgaccccaaggcgggcatcatgatcaaaagtgtgaaacgcgcctaccat
cggctctgtctgcattgttccgcggaccaggagggcaagtcagtgctgtcggaaaaattc
atcctgaaagtgaggccagccttcaaagctgtgcctgttgtgtctgtgtccaaagcaagc
tatcttcttagggaaggggaagaattcacagtgacgtgcacaataaaagatgtgtctagt
tctgtgtactcaacgtggaaaagagaaaacagtcagcagactaaactacaggagaaatat
aatagctggcatcacggtgacttcaattatgaacgtcaggcaacgttgactatcagttca
gcgagagttaatgattctggagtgttcatgtgttatgccaataatacttttggatcagca
aatgtcacaacaaccttggaagtagtagataaaggattcattaatatcttccccatgata
aacactacagtatttgtaaacgatggagaaaatgtagatttgattgttgaatatgaggca
ttccccagacctgaacaccagcactggatctatatgaacagaaccttcactgataaatgg
gaagattatcccaagtctgagaatgaaagtaatatcagatacgtaagtgaacttcatcta
accagattaaaaggcaccgaaggaggcacttacacattcctagtgtccaattctgacgtc
aatgcttccatagcatttaatgtttatgtgaatacaaaaccagaaatcctgacttacgac
aggctcgtgaatggcatgctccaatgtgtggcagcaggattcccagagcccacaatagat
tggtatttttgtccaggaactgagcagagatgctctgcttctgtactgccagtggatgtg
cagacactaaactcatctgggccaccgtttggaaagctagtggttcagagttctgtagat
tctagtgcattcaagcacaatggcacggttgaatgtaaggcttacaacgatgtgggcaag
acttctgcctattttaactttgcatttaaaggtaacaacaaagagcaaatccatccccac
accctgttcactcctttgctgattggtttcgtaatcgtagctggcatgatgtgcattatt
gtgatgattctgacctacaaatatttacagaaacccatgtatgaagtacagtggaaggtt
gttgaggagataaatggaaacaattatgtttacatagacccaacacaacttccttatgat
cacaaatgggagtttcccagaaacaggctgagttttgggaaaaccctgggtgctggtgct
ttcgggaaagttgttgaggcaactgcttatggcttaattaagtcagatgcggctatgact
gtagctgtaaagatgctcaaaccaagtgcccatttaacagaacgggaagccctcatgtct
gaactcaaagtcttgagttaccttggtaatcatatgaatattgtgaatcttcttggagcc
tgcaccattggagggcccaccttggtcattacagaatattgttgctatggtgatcttttg
aattttttgagaagaaaacgtgattcatttatttgttcaaagcaggaagatcatgcagaa
gctgcactttataagaatcttctgcattcaaaggagtcttcctgcagcgatagtaccaat
gagtacatggacatgaaacctggagtctcttatgttgtcccaaccaaggccgacaaaagg
agatctgcgagaataggctcatacatagaaagagatgtgactcctgccatcatggaggat
gatgagttggccctagacttagaagacttgctgagcttttcttaccaggtggcaaagggc
atggccttcctcgcctccaagaattgtattcacagagacttggcagccagaaatatcctc
cttactcatggtcggatcacaaagatttgtgattttggtctagccagagacatcaagaat
gattctaattatgtggttaaaggaaacgctcgactacctgtgaagtggatggcacctgaa
agcattttcaactgtgtatacacgtttgaaagtgacgtctggtcctatggtatttttctt
tgggagctgttctctttaggaagcagcccctatcctggaatgccggtcgattctaagttc
tacaagatgatcaaggaaggcttccggatgctcagccctgaacatgcacctgctgaaatg
tatgacataatgaagacttgctgggatgtggatcccctaaaaagaccaacattcaagcaa
attgttcagctaattgagaagcagatttcagagagcactaatcacatttactccaactta
gcaaactgcagccccaaccgacagaagcccgtggtggaccattctgtgcggatcaattct
gtcggcagcaccgcttcctcctcccagcctctgcttgtgcacgatgacgtctga

DBGET integrated database retrieval system