KEGG   Pongo abelii (Sumatran orangutan): 100440197
Entry
100440197         CDS       T01416                                 

Gene name
TIMP3
Definition
(RefSeq) metalloproteinase inhibitor 3
  KO
K16866  metalloproteinase inhibitor 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100440197 (TIMP3)
   05205 Proteoglycans in cancer
    100440197 (TIMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100440197 (TIMP3)
Peptidases and inhibitors [BR:pon01002]
 Peptidase inhibitors
  Family I35: timp family
   100440197 (TIMP3)
SSDB
Motif
Pfam: TIMP
Other DBs
NCBI-GeneID: 100440197
NCBI-ProteinID: XP_002831091
Ensembl: ENSPPYG00000011757
UniProt: A0A663D5M8 H2P465
LinkDB
Position
22
AA seq 211 aa
MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSIINATDP
NT seq 636 nt   +upstreamnt  +downstreamnt
atgactccttggctcgggctcatcgtgctcctgggcagctggagcctgggggactggggc
gccgaggcgtgcacatgctcgcccagccacccccaggacgccttctgcaactctgacatc
gtgatccgggccaaggtggtggggaagaagctggtaaaggaggggcccttcggcacgctg
gtctacaccatcaagcagatgaagatgtaccgaggcttcaccaagatgccccacgtgcag
tacatccacacggaagcttccgagagtctctgcggccttaagctggaggtcaacaagtac
cagtacctgctgacaggtcgcgtctacgatggcaagatgtacacagggctgtgcaacttt
gtggagaggtgggaccagctcaccctctcccagcgcaaggggctgaactatcggtaccac
ctgggttgtaactgcaagatcaagtcctgctactacctgccttgctttgtgacttccaag
aacgagtgtctctggaccgacatgctctccaatttcggttaccctggctaccagtccaaa
cactacgcctgcatccggcagaagggcggctactgcagctggtaccgaggatgggccccc
ccggacaaaagcatcatcaatgccacagacccctga

DBGET integrated database retrieval system