KEGG   Pongo abelii (Sumatran orangutan): 100440586
Entry
100440586         CDS       T01416                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X3
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01523  Antifolate resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04062  Chemokine signaling pathway
pon04064  NF-kappa B signaling pathway
pon04068  FoxO signaling pathway
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04210  Apoptosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04910  Insulin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05212  Pancreatic cancer
pon05215  Prostate cancer
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100440586 (IKBKB)
   04014 Ras signaling pathway
    100440586 (IKBKB)
   04064 NF-kappa B signaling pathway
    100440586 (IKBKB)
   04668 TNF signaling pathway
    100440586 (IKBKB)
   04068 FoxO signaling pathway
    100440586 (IKBKB)
   04151 PI3K-Akt signaling pathway
    100440586 (IKBKB)
   04150 mTOR signaling pathway
    100440586 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100440586 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100440586 (IKBKB)
   04621 NOD-like receptor signaling pathway
    100440586 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    100440586 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    100440586 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    100440586 (IKBKB)
   04660 T cell receptor signaling pathway
    100440586 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    100440586 (IKBKB)
   04659 Th17 cell differentiation
    100440586 (IKBKB)
   04657 IL-17 signaling pathway
    100440586 (IKBKB)
   04662 B cell receptor signaling pathway
    100440586 (IKBKB)
   04062 Chemokine signaling pathway
    100440586 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100440586 (IKBKB)
   04920 Adipocytokine signaling pathway
    100440586 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100440586 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100440586 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440586 (IKBKB)
   05206 MicroRNAs in cancer
    100440586 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100440586 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100440586 (IKBKB)
   05221 Acute myeloid leukemia
    100440586 (IKBKB)
   05220 Chronic myeloid leukemia
    100440586 (IKBKB)
   05215 Prostate cancer
    100440586 (IKBKB)
   05222 Small cell lung cancer
    100440586 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100440586 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100440586 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100440586 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    100440586 (IKBKB)
   04931 Insulin resistance
    100440586 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100440586 (IKBKB)
   05135 Yersinia infection
    100440586 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100440586 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    100440586 (IKBKB)
   05161 Hepatitis B
    100440586 (IKBKB)
   05160 Hepatitis C
    100440586 (IKBKB)
   05171 Coronavirus disease - COVID-19
    100440586 (IKBKB)
   05164 Influenza A
    100440586 (IKBKB)
   05162 Measles
    100440586 (IKBKB)
   05168 Herpes simplex virus 1 infection
    100440586 (IKBKB)
   05163 Human cytomegalovirus infection
    100440586 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100440586 (IKBKB)
   05169 Epstein-Barr virus infection
    100440586 (IKBKB)
   05165 Human papillomavirus infection
    100440586 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100440586 (IKBKB)
   05142 Chagas disease
    100440586 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100440586 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100440586 (IKBKB)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100440586 (IKBKB)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100440586 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Glyco_hydro_65m
Other DBs
NCBI-GeneID: 100440586
NCBI-ProteinID: XP_002819086
Ensembl: ENSPPYG00000018550
UniProt: A0A663D575 H2PQ71
LinkDB
Position
8
AA seq 697 aa
MSSDGTIRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLRE
GAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLC
TSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKS
EVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGC
FKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGL
ALIPDKPATQCVSDGKLNEGRTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKR
NLAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQL
KAKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMA
LQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQ
SFEKKVRVIYTQLSKTVVCKQKALELLPKVEELVSLMNEDEKTVVRLQEKRQKELWNLLK
IACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLL
ENAIQDTVREQHQSFTALDWSWLQTEEEEHSCLEQAS
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgtcatccgatggcacaatcaggctgacccaccccaatgtggtggctgcccgagatgtc
cctgaggggatgcagaacttggcgcccaatgacctgcccctgctggccatggaatactgc
caaggaggagatctccggaagtacctgaaccagtttgagaactgctgtggtctgcgggaa
ggcgccatcctcaccttgctgagtgacattgcctctgcgcttagataccttcatgaaaac
agaatcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggagaacagagg
ttaatacacaaaattattgacctaggatatgccaaggagctggatcagggcagtctttgc
acatcattcgtggggaccctgcagtacctggccccagagctactggagcagcagaagtac
acagtgaccgtcgactactggagcttcggcaccctggcctttgagtgcatcacgggcttc
cggcccttcctccccaactggcagcccgtgcaatggcattcgaaagtgcggcagaagagt
gaggtggacattgttgttagcgaagacttgaatggaacagtgaagttttcaagttcttta
ccctaccccaataatcttaacagcgtcctggctgagcgactggagaagtggctgcaactg
atgctgatgtggcatccccgacagaggggcacagatcccacgtatgggcccaacggctgc
ttcaaggccctggatgacatcttaaacttaaagctggttcatatcttgaacatggtcacg
ggcaccatccacacctaccctgtgacagaggatgagagtctgcagagcttgaaggccaga
atccagcaggacacaggcatcccagaggaggaccaggagctgctgcaggaagcgggcctg
gcgttgatccccgataagcctgccactcagtgtgtttcagacggcaagttaaatgagggc
cgcacattggacatggatcttgtttttctctttgacaacagtaaaatcacctatgaaact
cagatctccccacggccccaacctgaaagtgtcagctgtatccttcaagagcccaagagg
aacctcgccttcttccagctgaggaaggtgtggggccaggtctggcacagcatccagacc
ctgaaggaggattgcaaccggctgcagcagggacagcgagccgccatgatgaatctcctc
cgaaacaacagctgcctctctaagatgaagaattccatggcttccatgtctcagcagctc
aaggccaagttggatttcttcaaaaccagcatccagattgacctggagaagtacagcgag
caaaccgagtttgggatcacatcagataaactgctgctggcctggagggaaatggagcag
gctgtggagctctgtgggcgggagaacgaagtgaaactcctggtagaacggatgatggct
ctacagaccgacatcgtagacttacagcggagccccatgggccggaagcaggggggaacg
ctggacgacctagaggagcaagcaagggagctgtacaggagactaagggaaaaacctcga
gaccagcgaactgagggtgacagtcaggaaatggtacggctgctgcttcaggcaattcag
agcttcgagaagaaagtgcgagtgatctatacgcagctcagtaaaactgtggtttgcaag
cagaaggcactggaactgttgcccaaggtggaagagttggtgagcttaatgaatgaggat
gagaagactgttgtccggctgcaggagaagcggcagaaggaactctggaatctcctgaag
attgcttgtagcaaggtccgtggtcctgtcagtggaagcccggatagcatgaatgcctct
cgacttagccagcctgggcagctgatgtctcagccctccacggcctccaacagcttacct
gagccagccaagaagagtgaagaactggtggctgaagcacataacctctgcaccctgcta
gaaaatgccatacaggacaccgtgagggaacaacaccagagtttcacggccctagactgg
agctggttacagacggaagaagaagagcacagctgcctggagcaggcctcatga

DBGET integrated database retrieval system