KEGG   Pongo abelii (Sumatran orangutan): 100442478
Entry
100442478         CDS       T01416                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules
pon04640  Hematopoietic cell lineage
pon04810  Regulation of actin cytoskeleton
pon05145  Toxoplasmosis
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100442478 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100442478 (ITGA6)
   04514 Cell adhesion molecules
    100442478 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100442478 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100442478 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100442478 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100442478 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100442478 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100442478 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100442478 (ITGA6)
   05414 Dilated cardiomyopathy
    100442478 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100442478 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100442478 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100442478 (ITGA6)
   04515 Cell adhesion molecules [BR:pon04515]
    100442478 (ITGA6)
   04090 CD molecules [BR:pon04090]
    100442478 (ITGA6)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100442478 (ITGA6)
  Exosomal proteins of breast milk
   100442478 (ITGA6)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100442478 (ITGA6)
CD molecules [BR:pon04090]
 Proteins
  100442478 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Other DBs
NCBI-GeneID: 100442478
NCBI-ProteinID: XP_024098928
Ensembl: ENSPPYG00000012936
LinkDB
Position
2B
AA seq 1091 aa
MAAAGHLCLLYLSAGLLPRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEHVFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTK
PTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINVQKTITVTPNR
IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKITCEPQNEINVLNLKESHNSRK
KREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNGT
FLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQW
ITKWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggccgccgcggggcatctgtgcttgctctacctgtcggcggggctcctgccccggctc
ggcgcagccttcaacttggacactcgggaggacaacgtgatccggaaatatggagacccc
gggagcctcttcggcttctcgctggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgctcgtgggggccccgcgggcagaagcgcttccactgcagagagccaacagaacg
ggagggctgtacagctgcgacatcaccgcccgggggccatgcacgcggattgaatttgat
aacgatgctgaccccacgtcagaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccagggggcaaggtcgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacgaagcaggaatcccgagacatctttgggcggtgttatgtcctgagccagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgattgaga
ggccatgagaaatttggctcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtatttggagccccgggtacttataactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgagcacgatgaaagtctcgttcctgttcccgctaacagttacttaggtttt
tctctggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
cccagagccaatcacagtggagccgtggttttgctaaagagagacatgaagtctgcacat
ctcctccctgagcacgtattcgatggagaaggtctggcctcttcatttggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtaaagccaattcgtcttaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctcca
tatgatgacttgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
ccaacacaggttctcaagggtatatcaccttattttggatattcaattgctggaaacatg
gaccttgatcgaaattcctaccctgatgttgctgttggttccctctcagattcagtaact
attttcagatcccggcctgtgattaatgttcagaaaaccatcacagtaactcctaacaga
attgacctccgccagaaaacagcgtgtggggcgcctagcgggatatgcctccaggttaaa
tcctgtttcgaatatactgctaaccccgctggttataatccttcaatatcaattgtgggc
acacttgaagctgaaaaagaaagaagaaaatctgggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatactcaagaactaactctgaagcggcagaaacagaaa
gtgtgcatggaggaaaccctgtggctacaggataatattagagataaactgcgtcccatt
cccataactgcttcagtggagatccaagagccaagctctcgtaggcgagtgaattcactt
ccagaagttcttccaattctgaattcagatgaacccaagacagctcatattgatgttcac
tttttaaaagagggatgtggagacgacaatgtatgtaacagcaaccttaaactagaatat
aaattttgcacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaacccaaggaatcccacaaaagatggcgatgatgcccatgaggctaaactg
attgcaacgtttccggacactttaacatattccgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgccaaccagaatggctcacaagctgactgtgagcttgga
aatccttttaaaagaaattcaaatgtcactttttatttggttttaagtacaactgaagtc
acctttgacaccccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctcg
ggagttgctaaaccttcccaggtgtattttggaggtacagtagttggtgaacaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaataaacttaggt
aaacctcttacaaacctcggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatgggaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaagataact
tgtgagccacaaaatgagataaatgtcctgaacctaaaggagtctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagacgataacagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagcgtgaacgtgaactgtgtgaacatcagatgccca
ctgcgagggctggacagcaaggcgtctcttattttgcgctcgaggttatggaatggcaca
tttctagaggaatattccaaactgaactacttggacattctcatgcgagccttcattgat
gtgactgctgctgctgaaaatatcaggctgccaaatgcaggcactcaggttcgtgtgact
gtgtttccctcaaagactgtagctcagtattcgggagtaccttggtggatcatcctagtg
gctattctcgctgggatcttgatgcttgctttattagtgtttatactatggaagtgtgga
ttctttaaacgctctaggtacgatgacagtgttccccgataccatgccgtaaggatccgg
aaagaagagcgagagatcaaagatgaaaagtatattgataaccttgaaaaaaaacagtgg
atcacaaagtggaatgaaaatgaaagctactcatag

KEGG   Pongo abelii (Sumatran orangutan): 100451792
Entry
100451792         CDS       T01416                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V
  KO
K06487  integrin alpha V
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules
pon04810  Regulation of actin cytoskeleton
pon04919  Thyroid hormone signaling pathway
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100451792 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100451792 (ITGAV)
   04514 Cell adhesion molecules
    100451792 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100451792 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100451792 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100451792 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100451792 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100451792 (ITGAV)
   05205 Proteoglycans in cancer
    100451792 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100451792 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100451792 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    100451792 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100451792 (ITGAV)
   05414 Dilated cardiomyopathy
    100451792 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100451792 (ITGAV)
   05165 Human papillomavirus infection
    100451792 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100451792 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100451792 (ITGAV)
   04515 Cell adhesion molecules [BR:pon04515]
    100451792 (ITGAV)
   04090 CD molecules [BR:pon04090]
    100451792 (ITGAV)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100451792 (ITGAV)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100451792 (ITGAV)
  Exosomal proteins of epithelial cells
   100451792 (ITGAV)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100451792 (ITGAV)
CD molecules [BR:pon04090]
 Proteins
  100451792 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 100451792
NCBI-ProteinID: XP_024099080
Ensembl: ENSPPYG00000013007
LinkDB
Position
2B
AA seq 1048 aa
MASPPRRRLRLGPRVLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggcttctccgccgcggcgacggctgcgcctcggtccccgcgtcctcccgcttcttctc
tcgggactcctgctacctctgtgccgcgccttcaacctagacgtggacagtcctgccgag
tactctggccccgagggaagttacttcggcttcgcggtggatttcttcgtgcccagcgcg
tcttcccggatgtttcttctcgtgggagctcccaaagcaaacaccacccagcctgggatt
gtggaaggagggcaagtcctcaaatgtgactggtcttctacccgccggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggatgatccattggaatttaagtcc
catcagtggtttggagcatctgtgaggtcgaaacaggataaaattttggcctgtgcccca
ttgtaccattggaggactgagatgaaacaggagcgagagcctgttggaacatgctttctt
caagatggaacaaagactgttgagtatgctccatgtagatcacaagatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcagcttatttcggatcaagtggcagaa
atcgtatctaaatatgaccccaatgtttacagcatcaagtataataaccaattagcaact
cgaactgcacaagctattttcgatgacagttatttgggttactctgtggctgttggagat
ttcaatggtgatggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaagaacatgtcctccttatataattttactggcgag
cagatggctgcatatttcggattttctgtagctgccactgacattaatggagatgattat
gcagatgtgtttattggagcacctctcttcatggatcgtggctctgatggcaaactccaa
gaggtggggcaggtctcagtgtctctacagagagcttcaggagacttccagacgacaaag
ctgaatgggtttgaggtctttgcacggtttggcagtgccatagctcctttgggagatctg
gaccaggatggtttcaacgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatatcttcaatggaagatcaacaggcttgaacgcagtcccatcacaaatc
cttgaagggcagtgggctgctcgaagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacaaaaatggatatccagacttaattgtaggagcttttggtgtagat
cgagctatcttatacagggccagaccagttatcactgtaaatgctggtcttgaagtgtac
cctagcattttaaatcaagacaataaaacctgctcactgcctggaacagctctcaaagtt
tcctgttttaatgttaggttctgcttaaaggcagatggcaaaggagtacttcccaggaaa
cttaatttccaggtggaacttcttttggataaactcaagcaaaagggagcaattcgacga
gcactgtttctctacagcaggtccccaagtcactccaagaacatgactatttcaaggggg
ggactgatgcaatgtgaggaattgatagcgtatctgcgggatgaatctgaatttagagac
aaactcactccaattactatttttatggaatatcggttggattatagaacagctgctgat
acaacaggcttgcaacccattcttaaccagttcacgcctgctaacattagtcgacaggct
cacattctccttgactgtggtgaagacaatgtctgtaaacccaagctggaagtttctgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgacattgattgttaag
gctcagaatcaaggagaaggtgcctatgaagctgagctcatcgtttccattccactgcag
gctgatttcatcggggttgtccgaaacaatgaagccttagcaagactttcctgtgcattt
aagacagaaaaccaaactcgccaggtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcttagctggtcttcgtttcagtgtgcaccagcagtcagagatggatacttct
gtgaaatttgacttacaaatccaaagctcaaatctatttgacaaagtaagcccagttgta
tctcacaaagttgaccttgctgttttagctgcagttgagataagaggagtctctagtcct
gatcatatctttcttccgattccaaactgggagcacaaggagaaccctgagactgaagaa
gatgttgggccagttgttcagcacatctatgagctgagaaacaatggtccaagttcattc
agcaaggcaatgctccatcttcagtggccttacaaatataataataatactctgttgtat
atccttcattatgatattgatggaccaatgaactgcacttcagatatggagatcaaccct
ttgagaattaagatctcatctttgcaaacaactgaaaagaatgacacggttgctgggcaa
ggtgagcgggaccatctcatcactaagcgggatcttgccctcagtgaaggagatattcac
actttgggttgcggagtcgctcagtgcttgaagattgtctgccaagttgggcgattagac
agaggaaagagtgcaatcttgtacgtaaagtcattactgtggactgagacgtttatgaat
aaagaaaatcagaatcattcctattctctgaagtcatctgcttcatttaatgtcatagag
tttccttataagaatcttccaattgaggatatcaccaactccacattggttaccactaat
gtcacctggggcattcagccagcgcccatgcctgtgcctgtgtgggtgatcattttagca
gttctagcaggattgttgctactggctgttttggtatttgtaatgtacaggatgggcttt
tttaaacgggtccggccacctcaagaagaacaagaaagggaacagcttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

KEGG   Pongo abelii (Sumatran orangutan): 100452800
Entry
100452800         CDS       T01416                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04640  Hematopoietic cell lineage
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100452800 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    100452800 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100452800 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100452800 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100452800 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100452800 (ITGA2B)
   04611 Platelet activation
    100452800 (ITGA2B)
   04613 Neutrophil extracellular trap formation
    100452800 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452800 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100452800 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100452800 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    100452800 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100452800 (ITGA2B)
   05414 Dilated cardiomyopathy
    100452800 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100452800 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100452800 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100452800 (ITGA2B)
   04515 Cell adhesion molecules [BR:pon04515]
    100452800 (ITGA2B)
   04090 CD molecules [BR:pon04090]
    100452800 (ITGA2B)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100452800 (ITGA2B)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100452800 (ITGA2B)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100452800 (ITGA2B)
CD molecules [BR:pon04090]
 Proteins
  100452800 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 100452800
NCBI-ProteinID: XP_002827479
Ensembl: ENSPPYG00000008330
UniProt: A0A663D9T1 H2NTU0
LinkDB
Position
17
AA seq 1039 aa
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSHFGFSLDFHKDS
HGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLFFDLRDETRNVGSQTLQTFKA
RQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGN
TLSRIYMENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRP
GILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEI
LDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQV
LVFLGQSEGLSSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYR
AQPVVKASVQLLVQDSLNPAVRSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQ
LDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSL
NVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADN
VLELQMDAANEGEGAYEAELAVHLPQGTHYMRALSNVEGFERLICNQKKENETRVVLCEL
GNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVE
LRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQP
SDLLYILDIQPQGGLQCFPQPHVNPLKVDWGLPTPSPSPIHPAHHKRDRRQIFLPEPEQP
SRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAW
FNVSSLPYAVPPLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWK
VGFFKRNRPPLEEDDEEGE
NT seq 3120 nt   +upstreamnt  +downstreamnt
atggccagagctttgtgtccactgcaagccctctggcttctggagtgggtgctgctgctc
ttgggaccttgtgctgcccctccagcctgggccttgaacctggacccagtgcagctcacc
ttctatgcaggccccaatggcagccactttggattttcactggacttccacaaggacagc
catgggagagtggccatcgtggtgggcgccccgcggaccctgggccccagccaggaggag
acgggcggcgtgttcctgtgcccctggagggccgagggcggccagtgcccctcgctgttc
tttgacctccgtgatgagacccgaaatgtaggctcccaaactttacaaaccttcaaggcc
cgccaaggactgggggcgtcggtcgtcagctggagcgacgtcattgtggcctgcgccccc
tggcagcactggaacgtcctagaaaagactgaggaggctgagaagacgcccgtaggcagc
tgctttttggctcaaccagagagcggccgccgcgccgagtactccccctgtcgtgggaac
accctgagccgcatttacatggaaaatgattttagctgggacaagcgttactgtgaagcg
ggcttcagctccgtggtcactcaggccggagagctggtgcttggggctcctggcggctat
tatttcttaggtctcctggcccaggctccaattgcggatattttctcgagttaccgccca
ggcatccttttgtggcacgtgtcctcccagagcctctcctttgactccagcaacccagag
tacttcgacggctactgggggtactcggtggccgtgggcgagttcgacggggatctcaac
actacagagtatgtcgtcggtgcccccacttggagctggaccctgggagcggtggaaatt
ttggactcctactaccaaaggctgcaccggctgcgcggagagcagatggcgtcgtatttt
gggcattcagtggctgtcactgacgtcaacggggatgggaggcatgatctgctggtgggc
gctccgctgtatatggagagccgggcagaccgaaaactggccgaagtggggcgtgtgtat
ttgttcctgcagccgcgaggcccccacgcactgggtgcccccagcctcctgctgactggc
acacagctctatgggcgattcggctctgccatcgcacccctgggcgacctcgaccgggat
ggctacaatgacattgcagtggctgccccctatgggggtcccagtggccgcggccaagtg
ctggtgttcctgggtcagagtgaggggctgagctcacgtccctcccaggtcctggacagc
cccttccccacaggctctgcctttggcttctcccttcgaggtgccgtagacatcgatgac
aacggatacccagacctgatcgtgggagcttacggggccaaccaggtggctgtgtacaga
gctcagccagtggtgaaggcctctgtccagctactggttcaagattcactgaatcctgct
gtgaggagctgtgtcctaccccagaccaagacacccgtgagctgcttcaacatccagatg
tgtgttggagccactgggcacaacattcctcagaagctatccctaaatgccgagctgcag
ctggaccggcagaagccccgccagggccggcgggtgctgctgctgggctctcaacaggca
ggcaccaccctgaacctggatctgggtggaaagcacagccccatctgccacaccaccatg
gccttccttcgagatgaggcagacttccgggacaagctgagccccattgtgctcagcctc
aatgtgtccctaccgcccacggaggctggaatggcccctgctgtcgtgctgcatggagac
acccatgtgcaggagcagacacgaatcgtcctggactgcggggaagatgacgtgtgtgtg
ccccagcttcagctcactgccagcgtgacgggctccccgctcctagttggggcagataat
gtcctggagctgcagatggatgcagccaacgagggcgagggggcctatgaagcagagctg
gctgtgcacctgccccagggcacccactatatgcgggccctaagcaacgtcgagggcttt
gagagactcatctgtaatcagaagaaggagaatgagaccagggtggtgctgtgtgagctg
ggcaaccccatgaagaagaatgcccagataggaatcgcgatgttggtgagcgtggggaat
ctggaagaggctggggagtctgtgtccttccagctgcagatacggagcaagaacagccag
aatccaaacagcaagattgtgctgctggacgtgccggtccgagcagaggcccaagtggag
ctgcgagggaactcctttccagcctctctggtggtggcggcagaagaaggtgagagggag
cagaacagcttggacagctggggacccaaagtggagcacacctatgagctccacaacaat
ggccctgggactgtgaatggccttcacctcagcatccacctcccggggcagtcccagccc
tccgatctgctctacatcctggatatacagccccaggggggccttcagtgcttcccacag
cctcatgtcaaccccctcaaggtggactgggggctgcccacccccagcccctcccccatt
cacccggcccatcacaagcgggatcgcagacaaatcttcctgccagagcccgagcagccc
tcgaggcttcaggatccagttctcgtaagctgcgactcggcgccctgtactgtggtgcaa
tgtgaccttcaggagatggcgcgcgggcagcgggccatggtcacggtgctggccttcctg
tggctgcccagcctctaccagaggccactggatcagtttgtgctgcagtcgcacgcatgg
ttcaacgtgtcctccctcccctatgcggtgccccccctcagcctgccccgaggggaagct
caggtgcggacacagctgctccgggccttggaggagagggccattccaatctggtgggtg
ctggtgggtgtgctgggtggcctgctgctgctcaccatcctggtcctggccatgtggaag
gttggcttcttcaagaggaaccggccacccctggaagaagatgatgaagagggggagtga

KEGG   Pongo abelii (Sumatran orangutan): 100459915
Entry
100459915         CDS       T01416                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3
  KO
K06482  integrin alpha 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04640  Hematopoietic cell lineage
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100459915 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100459915 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100459915 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459915 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100459915 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459915 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100459915 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100459915 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100459915 (ITGA3)
   05414 Dilated cardiomyopathy
    100459915 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100459915 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100459915 (ITGA3)
   04515 Cell adhesion molecules [BR:pon04515]
    100459915 (ITGA3)
   04090 CD molecules [BR:pon04090]
    100459915 (ITGA3)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100459915 (ITGA3)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100459915 (ITGA3)
CD molecules [BR:pon04090]
 Proteins
  100459915 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N MLANA
Other DBs
NCBI-GeneID: 100459915
NCBI-ProteinID: XP_002834330
UniProt: H2NVM2 A0A6D2XU64
LinkDB
Position
17
AA seq 1051 aa
MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKSDPGHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYK
DPEDQGNLYIGYTVQVGSAILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEG
SQVGAYFGSAIALADLNNDGWQDLLVGAPYYFQRKEEVGGAVYVFMNQAGTSFPAHPSLL
LHGPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVARPAVL
DPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFH
GFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQA
QALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNT
RTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAF
EVIGVTLHTRDLQVQLQLSTSSHQDNLWPMTLTLLVDYTLQTSLSMVNHRLQSFFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITVHG
NGSWPCQPPGDLINPLNLTLSDPGDRPSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
VLTCATGRAHCVWLECPIPDAPIVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRT
SIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFK
RARTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3156 nt   +upstreamnt  +downstreamnt
atgggccccggccccagccgcgcgccccgcgccccacgcctgatgctctgtgcgctcgcc
ttgatggtggcggccggcggctgcgtcgtctccgccttcaacctggatacccgattcctg
gtagtgaaggaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcgg
cagacagagcggcagcagcgctacctgctgctggctggtgccccccgggagctcgctgtg
cccgatggctacaccaaccggactggtgctgtgtacctgtgcccactcactgcccacaag
gatgactgtgagcggatgaacatcacagtgaaaagtgaccctggccatcacattattgag
gacatgtggcttggagtgactgtggccagccagggccctgcaggcagagttctggtctgt
gcccaccgctacacccaggtgctgtggtcggggtcagaagaccagcggcgcatggtgggc
aagtgctacgtgcgaggcaatgacctagagctggactccagtgatgactggcagacctac
cacaacgagatgtgcaacagcaacacagactacctggagacgggcatgtgccagctgggc
accagcggtggcttcacccagaacactgtgtacttcggcgcccccggtgcctacaactgg
aaaggaaacagctacatgattcagcgcaaggagtgggacttatctgagtatagttacaag
gacccagaggaccaaggaaacctctatattgggtacacggtgcaggtaggcagcgccatc
ctgcaccccaaaaacatcaccattgtgacaggtgccccacggcaccgacatatgggcgcg
gtgttcttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggc
tcgcaggtgggcgcctattttggcagcgccattgccctggcagacctgaacaacgatggg
tggcaggacctcctggtgggggctccctactactttcagaggaaagaggaagtagggggt
gccgtctatgtcttcatgaaccaggcgggaacctccttccctgctcacccctcgctcctt
cttcatggccccagtggctccgccttcggcttatctgtggccagcattggtgacatcaac
caggatggatttcaggatattgccgtgggagctccgtttgaaggcttgggcaaagtgtac
atctatcacagtagctctaaggggctcctcagacagccccagcaggtaatccatggagag
aagctgggactgcctggcttggccaccttcggctattccctcagtgggcagatggatgtg
gatgagaacttctacccagaccttctagtgggaagcctgtcagaccacattgtgctgctg
cgggcccggcccgtcatcaacatcgtccacaagaccttggtggccaggccagctgtgctg
gaccctgcactttgcacggccacctcttgtgtgcaagtggagctgtgctttgcttacaac
cagagtgccgggaaccccaactacaggcgaaacatcaccctggcctacactctggaggcc
gacagggaccgccgcccgccccggctccgctttgccggcagtgagtccgctgtcttccac
ggcttcttctccatgccggaaatgcgctgccagaagctggagctgctcctgatggacaac
ctccgtgacaaactccgccccatcatcatctccatgaactattctttacctttgcggatg
cccgatcgcccccggctggggctgcggtccctggacgcctacccgatcctcaaccaggca
caggctctggagaaccacactgaggtccagttccagaaggagtgcgggcctgacaacaag
tgtgagagcaacttgcagatgcgggcagccttcgtgtcagagcagcagcagaagctgagc
aggctccagtacagcagagacgtccggaaactgctcctgagcatcaacgtgacgaacacc
cggacctcggagcgctccggggaggacgcccacgaggcgctgctcaccctggtggtgcct
cccgccctgctgctgtcctcagtgcgcccccctggggcctgccaagctaatgagaccatc
ttttgcgagctggggaaccccttcaaacgcaaccagaggatggagctgctcatcgccttc
gaggtcatcggggtgaccctgcacacaagggaccttcaggtgcagctgcagctctccacg
tcaagtcaccaggacaacctgtggcccatgaccctcactctgctggtggactatacactc
cagacctcgcttagcatggtaaatcaccggctacaaagcttctttggggggacagtgatg
ggcgagtctggcatgaaaactgtggaggatgtaggaagccccctcaagtatgaattccag
gtgggcccaatgggggaggggctggtgggcctggggaccctggtcctaggtctggagtgg
ccctacgaagtcagcaacggcaagtggctgctgtatcccacggagatcaccgtccatggc
aatgggtcctggccctgccaaccacctggagaccttatcaaccctctcaacctcactctt
tctgaccctggggacaggccatcatccccacagcgcaggcggcgacagctggatccaggg
ggaggccagggccccccacctgtcactctggctgctgccaaaaaagccaagtctgagact
gtgctgacctgtgccacagggcgcgcccactgtgtgtggctagagtgccccatccctgat
gcccccattgtcaccaacgtgactgtgaaggcacgagtgtggaacagcaccttcatcgag
gattacagagactttgaccgagtccgagtaaatggctgggctaccctattcctccgaacc
agcatccccaccatcaacatggagaacaagaccacgtggttctccgtggacattgactcg
gagctggtggaggagctgccggccgagatcgagctgtggctggtgctggtggccgtgggt
gcagggctgctgctgctggggctgatcatcctcctgctgtggaagtgcggcttcttcaag
cgagcccgcactcgcgccctgtatgaagctaagaggcagaaggcggagatgaagagccag
ccgtcagagacagagaggctgaccgacgactactga

DBGET integrated database retrieval system