KEGG   Pongo abelii (Sumatran orangutan): 100442948
Entry
100442948         CDS       T01416                                 

Gene name
DRD2
Definition
(RefSeq) D(2) dopamine receptor
  KO
K04145  dopamine receptor D2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04540  Gap junction
pon04728  Dopaminergic synapse
pon05012  Parkinson disease
pon05030  Cocaine addiction
pon05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100442948 (DRD2)
   04024 cAMP signaling pathway
    100442948 (DRD2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100442948 (DRD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100442948 (DRD2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100442948 (DRD2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100442948 (DRD2)
  09165 Substance dependence
   05030 Cocaine addiction
    100442948 (DRD2)
   05034 Alcoholism
    100442948 (DRD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100442948 (DRD2)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    100442948 (DRD2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv DUF2207 RIFIN Stevor
Other DBs
NCBI-GeneID: 100442948
NCBI-ProteinID: XP_024111128
Ensembl: ENSPPYG00000003885
LinkDB
Position
11
AA seq 443 aa
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggatccactgaatctgtcctggtatgatgatgatttggagaggcagaactggagccgg
cccttcaatgggtcggatgggaaggcggacagaccccactacaactactatgccacgctg
ctcaccctgctcatcgctgtcatcgtcttcggcaacgtgctggtgtgcatggccgtgtcc
cgcgagaaggcactgcagaccaccaccaactacctgatcgtcagcctcgcggtggccgac
ctcctcgtggccacactggtcatgccttgggttgtctacctggaggtggtaggtgagtgg
aaattcagcaggattcactgtgacatcttcgtcactctggacgtcatgatgtgcacggcg
agcatcctgaacttgtgtgccatcagcatcgacaggtacacagctgtggccatgcccatg
ctgtacaatacgcgctacagctccaagcgtcgggtcaccgtcatgatctccatcgtctgg
gtcctgtccttcaccatctcctgcccactcctcttcggactcaataacacagaccagaac
gagtgcatcattgccaacccagcctttgtggtctactcctccatcgtctccttctacgtg
cccttcatcgtcaccctgctggtctacatcaagatctacattgtcctccgcagacgccgc
aagcgagtcaacaccaagcgcagcagccgagctttcagggcccacctgagggctccatta
aagggcaactgtactcaccccgaggacatgaaactctgcaccgttatcatgaagtctaat
gggagtttcccagtgaacaggcggagagtggaggctgcccggcgagcccaggagctggag
atggagatgctctccagcaccagcccacccgagaggacccggtacagccccatcccaccc
agccaccaccagctgactctccccgacccgtcccaccacggtctccacagcactcccgac
agccccgccaaaccagagaagaatgggcatgccaaagaccaccccaagattgccaagatc
tttgagatccagaccatgcccaatggcaaaacccggacctccctcaagaccatgagccgt
aggaagctctctcagcagaaggagaagaaagccactcagatgctcgccattgttctcggc
gtgttcatcatctgctggctgcccttcttcatcacacacatcctgaacatacactgtgac
tgcaacatcccgcctgtcctgtacagcgccttcacgtggctgggctatgtcaacagcgcc
gtgaaccccatcatctacaccaccttcaacattgagttccgcaaggccttcctgaagatc
ctccactgctga

DBGET integrated database retrieval system