KEGG   Pongo abelii (Sumatran orangutan): 100442963
Entry
100442963         CDS       T01416                                 

Definition
(RefSeq) bcl-2-like protein 2 isoform X3
  KO
K02163  apoptosis regulator BCL-W
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100442963
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100442963
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100442963
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100442963
Transporters [BR:pon02000]
 Other transporters
  Pores ion channels [TC:1]
   100442963
SSDB
Motif
Pfam: Bcl-2 BH4 ABATE Apolipoprotein HTH_AsnC-type
Other DBs
NCBI-GeneID: 100442963
NCBI-ProteinID: XP_002824629
UniProt: A0A2J8TRS5
LinkDB
Position
14
AA seq 193 aa
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcgaccccagcctcggccccagacacacgggctctggtggcagactttgtaggttat
aagctgaggcagaagggttatgtctgtggagctggccccggggaaggcccagcagctgac
ccgctgcaccaagccatgcgggcagctggggatgagttcgagacccgcttccggcgcacc
ttctctgatctggcggctcagctgcatgtgaccccaggctcagcccaacaacgcttcacc
caggtctccgatgaactttttcaagggggccccaactggggccgccttgtagccttcttt
gtctttggggctgcactgtgtgctgagagtgtcaacaaggagatggaaccactggtggga
caagtgcaggagtggatggtggcctacctggagacgcggctggctgactggatccacagc
agtgggggctgggcggagttcacagctctatacggggacggggccctggaggaggcgcgg
cgtctgcgggaggggaactgggcatcagtgaggacagtgctgacgggggccgtggcactg
ggggccctggtaactgtaggggccttttttgctagcaagtga

DBGET integrated database retrieval system