KEGG   Pongo abelii (Sumatran orangutan): 100443803
Entry
100443803         CDS       T01416                                 

Gene name
MLST8
Definition
(RefSeq) target of rapamycin complex subunit LST8
  KO
K08266  target of rapamycin complex subunit LST8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04136  Autophagy - other
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100443803 (MLST8)
   04150 mTOR signaling pathway
    100443803 (MLST8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100443803 (MLST8)
   04136 Autophagy - other
    100443803 (MLST8)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100443803 (MLST8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100443803 (MLST8)
Membrane trafficking [BR:pon04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100443803 (MLST8)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Hira Frtz
Other DBs
NCBI-GeneID: 100443803
NCBI-ProteinID: XP_009248609
Ensembl: ENSPPYG00000006991
UniProt: A0A6D2VS92 A0A2J8S8D9
LinkDB
Position
16
AA seq 326 aa
MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEITPDRSMIAAA
GYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQ
CQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDP
DASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSA
DQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVE
TGEIKREYGGHQKAVVCLAFNDSVLG
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaacacctccccaggcacggtgggcagtgacccggtcatcctggccactgcaggctac
gaccacaccgtgcgcttctggcaggcccacagcggcatctgcacccggactgtgcagcac
caggactcccaagtgaatgccttggagatcacaccagaccgcagcatgattgctgctgca
ggttaccagcatatccgcatgtatgatctcaactccaataaccctaaccccatcatcagt
tacgacggcgtcaacaagaacatcgcgtctgtgggcttccacgaagacggccgctggatg
tacacgggcggcgaggactgcacagccaggatctgggacctcaggtcccggaacctgcag
tgccagcggatcttccaggtgaacgcacccattaactgcgtgtgcctgcaccccaaccag
gcagagctcatcgtgggtgaccagagcggggctatccacatctgggacttgaaaacagac
cacaacgagcagctgatccctgagcctgaggtctccatcacgtctgcccacatcgacccc
gacgccagctacatggcagctgtcaatagcactggaaactgctatgtctggaatctgacg
gggggcattggtgacgaggtgacccagctcatccccaagaccaagatccctgcccacacg
cgctacgccctgcagtgtcgcttcagccccgactccacgctcctcgccacctgctcggct
gatcagacctgcaagatctggaggacgtccaacttctccttgatgacggagctgagcatc
aagagcggcaaccccggggagtcctctcgcggctggatgtggggctgcgccttctcgggg
gactcccagtacatcgtcaccgcttcctcggacaacctggcccggctctggtgtgtagag
actggagaaatcaagagagagtatggcggccaccagaaggctgttgtctgcctggccttc
aacgacagtgtgctgggctag

DBGET integrated database retrieval system