KEGG   Pongo abelii (Sumatran orangutan): 100444556
Entry
100444556         CDS       T01416                                 

Gene name
SERPINB5
Definition
(RefSeq) serpin B5
  KO
K10139  serpin B5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04115  p53 signaling pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100444556 (SERPINB5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100444556 (SERPINB5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100444556 (SERPINB5)
Peptidases and inhibitors [BR:pon01002]
 Peptidase inhibitors
  Family I4: serpin family
   100444556 (SERPINB5)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 100444556
NCBI-ProteinID: XP_024091884
Ensembl: ENSPPYG00000009215
LinkDB
Position
18
AA seq 375 aa
MDALRLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHF
ENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVD
FKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFPESET
KECPFRVNKTDTKPVQMMNLEATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDES
TGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEKVIDPKASLENLGLKHIFSED
TSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNADHPFIYIIRH
NKTRNIIFFGKFCSP
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgccctgcgactagcaaattcagcttttgctgttgatctgttcaaacaactatgt
gaaaaggagccactgggcaatgtcctcttctctccaatctgtctctccacctctctgtca
cttgctcaagtgggtgctaaaggtgacactgcaaatgaaattggacaggttcttcatttt
gaaaatgtcaaagatgtgccctttggatttcaaacagtaacatcggatgtaaacaaactt
agttccttttactcactgaaactaatcaagcggctctacgtggacaaatctctgaatctt
tctacagagttcatcagctctacgaagagaccctatgcaaaggaactggaaactgttgac
ttcaaagataaactggaagaaacgaaaggtcagatcaacaactcaattaaggatctcaca
gatggccactttgagaacattttagctgacaacagtgtgaacgaccagaccaaaatcctt
gtggttaatgctgcctactttgttggcaagtggatgaagaaatttcctgaatcagaaaca
aaagaatgtcctttcagagtcaacaagacagacaccaaaccagtgcagatgatgaacctg
gaggccacgttctgtatgggaaacattgacagtatcaattgtaagatcatagagcttcct
tttcaaaataagcatctcagcatgttcatcctgctacccaaggatgtggaggatgagtcc
acaggcttggagaagattgaaaaacaactcaactcagagtcgctgtcgcagtggactaat
cccagcaccatggccaatgccaaggtcaaactctccattccaaaatttaaggtggaaaag
gtgattgatcccaaggctagtctggaaaatctagggctgaaacatatcttcagtgaagac
acatctgatttctctggaatgtcagagaccaagggagtggccctatcaaatgttatccac
aaagtgtgcttagaaataactgaagatggtggggattccatagaggtgccaggagcacgg
atcctgcagcacaaggatgaattgaatgctgaccatccctttatttacatcatcaggcac
aacaaaactcgaaacatcattttctttggcaaattctgttctccttaa

DBGET integrated database retrieval system