KEGG   Pongo abelii (Sumatran orangutan): 100444798
Entry
100444798         CDS       T01416                                 

Gene name
STAM2
Definition
(RefSeq) signal transducing adapter molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100444798 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100444798 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100444798 (STAM2)
Membrane trafficking [BR:pon04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    100444798 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT ENTH
Other DBs
NCBI-GeneID: 100444798
NCBI-ProteinID: XP_003776054
Ensembl: ENSPPYG00000012850
LinkDB
Position
2B
AA seq 525 aa
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPPAGSQTVSAAAKNGTSSNKNKEDEDIAKAIELSLQE
QKQQHTETKSLYPSSEIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTTNLNIETEAAAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALEL
YNKLVNEAPVYSVYSKLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSL
GPDQIGPLRSLPSNVNSSVTTQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQ
MGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgcctttgttcaccgccaaccccttcgagcaagacgtggaaaaagccacgaatgagtac
aacactacagaagattggagtcttattatggacatatgtgacaaagttggaagtactcct
aatggagcaaaagattgcctaaaagccataatgaaaagagtaaatcataaggttccacat
gttgctctgcaggcactaactcttcttggggcttgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacagaagtacgtgctgtgattaaaaataag
gcacatcctaaagtatgtgaaaaactgaaatctttaatggtggagtggtcagaagaattt
cagaaggaccctcagtttagtctaatatctgcaactattaaatctatgaaagaagaagga
attacttttcctccagcaggttctcagactgtctcagctgctgccaagaatggtacgtca
tcgaacaaaaacaaagaggatgaagacatagctaaagctattgaattatcgctgcaagaa
cagaaacagcaacacacagaaacaaaatccttatatccatcctcagaaattcagttaaat
aataaggttgcacggaaagtgagagctttatatgattttgaagctgttgaagacaatgaa
ctcacctttaaacatggtgaaataattattgttttggatgacagtgatgccaattggtgg
aaaggagaaaatcacagaggaataggacttttcccatccaattttgtaacaactaattta
aacatagagactgaggcagcggctgtggacaaattgaatgtaattgatgatgacgtggag
gaaattaagaaatcagagcctgagcctgtttatatagatgaggataagatggatagagcc
ctgcaggtacttcagagtatagatccaacagattcaaaaccagactcccaggaccttttg
gatttagaagatatctgccaacagatgggtccaatgatagatgaaaaacttgaagaaatt
gataggaagcattcagaattgtctgaattgaatgtaaaagtcctggaagctctggaacta
tataacaaattggtgaatgaagcaccagtgtactcagtctattcaaagctccaccctcca
gcacattacccacctgcatcatctggggttccaatgcagacatatccagttcaatcacat
ggtggaaactatatgggtcagagcattcaccaagtaactgttgcccaaagctatagccta
ggacccgatcagattggtccactgagatctctgccttcaaatgtgaattcctcagtgaca
acacagcctgctcaaacttcatatttaagcactggacaagacactgtttccaatcctact
tatatgaaccagaactctaacctacagtcagctactggtacaactgcttacacacagcaa
atggggatgtctgtggatatgtcgtcttatcagaacactacttccaatttgcctcagctg
gcaggctttccggtgacagttccagctcatccagttgcacagcagcacacaaattaccat
cagcagcctctcctttag

KEGG   Pongo abelii (Sumatran orangutan): 100446981
Entry
100446981         CDS       T01416                                 

Gene name
STAM
Definition
(RefSeq) signal transducing adapter molecule 1 isoform X1
  KO
K04705  signal transducing adaptor molecule
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04144  Endocytosis
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100446981 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100446981 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100446981 (STAM)
Membrane trafficking [BR:pon04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    100446981 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 100446981
NCBI-ProteinID: XP_002820612
Ensembl: ENSPPYG00000002126
UniProt: H2N9W0 A0A6D2XZ09
LinkDB
Position
10
AA seq 540 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVY
SPPPAATAAAATADVTLYQNAGPSMPQVPNYNLTSSTLPQTGGSQQPPQPQQPYSQKALL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgcctctgtttgccaccaatcccttcgatcaggatgttgagaaagcaaccagcgagatg
aatactgctgaggactggggcctcattttggatatctgtgataaagttggtcagtctcgc
actggacctaaggattgtcttcggtctattatgagaagagtgaaccacaaagatcctcac
gttgctatgcaagctttgactcttctaggagcatgtgtatcaaactgtggcaaaattttt
catttagaagtatgttcaagagattttgctagtgaagtaagcaacgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgatccacagcttagtctaatatcagcaatgattaagaaccttaaggaacaaggagtt
acgttcccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctcttgta
gccaaggatcctggtactgtggctaacaaaaaagaagaagaagatttagcaaaagccatt
gagttgtctctcaaggagcaaaggcagcagtcaaccaccctttccactttgtatccaagc
acatccaatctcttaactaaccaccaacatgaaggccgaaaagttcgtgctatatatgac
ttcgaagctgctgaagataatgaacttacttttaaagccggagaaattattacagttctt
gatgacagtgatcctaactggtggaaaggtgaaacccatcaaggcatagggttatttcct
tctaattttgtgactgcagatctcactgctgaaccagaaatgattaaaacagagaagaag
acggtacaatttagtgatgatgttcaggtagagacaatagaaccagagccggaaccagcc
tttattgatgaagataaaatggaccagttgctacagatgctgcaaagtacagaccccagt
gatgatcagccagacctaccagagctacttcatcttgaagcaatgtgtcaccagatggga
cctctcattgatgaaaagctggaagatattgacagaaaacattcagaactctcagaactt
aatgtgaaagtgatggaggccctttccttatataccaagttaatgaacgaagatccgatg
tattccatgtatgcaaagttacagaatcagccgtattatatgcagtcgtctggtgtttct
ggttctcaggtgtatgcaggacctcctccaagtggtgcctacttggttgcagggaacgca
cagatgagccacctccagagctacagtcttcccccggagcagctgtcttctctcagccag
gcagtggtcccgccatccgcaaacccagcccttcctagtcagcagactcaggccgcttac
ccaaatacaatggtcagttccgttcaaggaaacacgtatcccagccaggcgccagtatat
agtcctcctcctgccgctactgctgctgctgcaactgccgatgtcactctgtaccagaat
gcaggacctagtatgccccaggtgccaaactataacttaacatcatcaactctgcctcag
accggaggcagccaacagccacctcagccacagcaaccatattctcagaaggctctgcta
tag

DBGET integrated database retrieval system