KEGG   Pongo abelii (Sumatran orangutan): 100445345
Entry
100445345         CDS       T01416                                 

Gene name
ITGB3
Definition
(RefSeq) integrin beta-3
  KO
K06493  integrin beta 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04640  Hematopoietic cell lineage
pon04810  Regulation of actin cytoskeleton
pon04919  Thyroid hormone signaling pathway
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05168  Herpes simplex virus 1 infection
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100445345 (ITGB3)
   04151 PI3K-Akt signaling pathway
    100445345 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100445345 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100445345 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100445345 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100445345 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100445345 (ITGB3)
   04611 Platelet activation
    100445345 (ITGB3)
   04613  Neutrophil extracellular trap formation
    100445345 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100445345 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100445345 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100445345 (ITGB3)
   05205 Proteoglycans in cancer
    100445345 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100445345 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    100445345 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100445345 (ITGB3)
   05414 Dilated cardiomyopathy
    100445345 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100445345 (ITGB3)
   05163 Human cytomegalovirus infection
    100445345 (ITGB3)
   05165 Human papillomavirus infection
    100445345 (ITGB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100445345 (ITGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100445345 (ITGB3)
   04515 Cell adhesion molecules [BR:pon04515]
    100445345 (ITGB3)
   04090 CD molecules [BR:pon04090]
    100445345 (ITGB3)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100445345 (ITGB3)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100445345 (ITGB3)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin beta subunits
   100445345 (ITGB3)
CD molecules [BR:pon04090]
 Proteins
  100445345 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 100445345
NCBI-ProteinID: XP_002834363
LinkDB
Position
17
AA seq 788 aa
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCHQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCALESIEFPVSEARVLEDRPLSNKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT
NT seq 2367 nt   +upstreamnt  +downstreamnt
atgcgagcgcggccgcggccccggccgctctgggcgactgtgctggcgctgggggcgctg
gcgggcgttggcgtcggagggcccaacatctgtaccacgcgaggtgtgagctcctgccat
cagtgcctggctgtgagccccatgtgtgcctggtgctctgatgaggccctgcctctgggc
tcacctcgctgtgacctgaaggagaatctgctgaaggataactgtgccctggaatccatc
gagttcccagtgagtgaggcccgagtactagaggacaggcccctcagcaacaagggctct
ggagacagctcccaggtcactcaagtcagtccccagaggattgcactccggctccggcca
gatgattcgaagaatttctccatccaagtgcggcaggtggaggattaccctgtggacatc
tactacttgatggacctgtcttactccatgaaggatgatctgtggagcatccagaacctg
ggtaccaagctggccacccagatgcgaaagctcaccagtaacctgcggattggcttcggg
gcatttgtggacaagcctgtgtcaccatacatgtatatctccccaccagaggccctcgaa
aacccctgctatgatatgaagaccacctgcttgcccatgtttggctacaaacacgtgctg
acgctcactgaccaggtgacccgcttcaatgaggaagtgaagaagcagagtgtgtcacgg
aaccgagatgccccagagggtggctttgatgctatcatgcaggctacagtctgtgatgaa
aagattggctggaggaatgacgcatcccacttgctggtgtttaccactgatgccaagact
catatagcactggacggaaggctggcaggcattgtccagcccaatgatgggcagtgtcat
gttggtagtgacaatcattactctgcctccactaccatggattatccctctttggggctg
atgactgagaagctatcccagaaaaacatcaatttgatctttgcagtgactgaaaatgta
gtcaatctctatcagaactatagtgagctcatcccagggaccacagtcggggttctgtcc
atggattccagcaatgtcctccagctcattgtcgatgcttatgggaaaatccgctctaaa
gtcgagctggaagtgcgtgacctccctgaagagttgtctctatccttcaatgccacctgc
ctcaacaatgaggtcatccctggcctcaagtcttgtatgggactcaagattggagacacg
gtgagcttcagcattgaggccaaagtgcgaggctgtccccaggagaaggagaagtccttt
accatcaagcccgtgggcttcaaggacagcctgatcgtccaggtcacctttgattgtgac
tgtgcctgccaggcccaagctgaacctaatagccatcgctgcaacaatggcaatgggacc
tttgagtgtggggtatgccgttgtgggcctggctggctgggatcccagtgtgagtgctca
gaggaggactatcgcccttcccagcaggacgagtgcagcccccgggagggtcagcccgtc
tgcagccagcggggcgagtgcctctgtggtcagtgtgtctgccacagcagtgactttggc
aagatcacgggcaagtactgcgagtgtgatgacttctcctgtgtccgctacaagggggag
atgtgctcaggccatggccagtgcagctgtggggactgcctgtgtgactctgactggacc
ggctactactgcaactgtaccacacgtactgacacctgcatgtccagcaatgggctgctg
tgcagcggccgcggcaagtgtgaatgtggcagctgtgtctgtatccagccaggctcctat
ggggacacctgtgagaagtgccccacctgcccagatgcctgcacctttaagaaagaatgt
gtggagtgtaagaagtttgatcggggagccctacatgacgaaaatacctgcaaccgttac
tgccgtgatgagattgagtcagtgaaagagcttaaggacactggcaaggatgcagtgaat
tgtacctataagaatgaggatgactgtgtcgtcagattccagtactatgaagattctagt
ggaaagtccatcctgtatgtggtagaagagccagagtgtcccaagggccctgacatcctg
gtggtcctgctctcagtgatgggggccattctgctcatcggccttgccgctctgctcatc
tggaagctcctcatcaccatccacgaccgaaaagagttcgctaaatttgaggaagaacgc
gccagagcaaaatgggacacagccaacaacccactgtataaagaggccacatctaccttc
accaatatcacgtaccggggcacttaa

DBGET integrated database retrieval system