KEGG   Pongo abelii (Sumatran orangutan): 100445348
Entry
100445348         CDS       T01416                                 

Gene name
SLC7A4
Definition
(RefSeq) cationic amino acid transporter 4
  KO
K13866  solute carrier family 7 (cationic amino acid transporter), member 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100445348 (SLC7A4)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100445348 (SLC7A4)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Other DBs
NCBI-GeneID: 100445348
NCBI-ProteinID: XP_009235110
LinkDB
Position
22
AA seq 635 aa
MARGLPSIASLARLCQKLNRLKPLEDSTMETSLRRCLSTLDLTLLGVGGMVGSGLYVLTG
AVAKEVAGPAVLLSFGVAAVASLLAALCYAEFGARVPRTGSAYLFTYVSMGELWAFLIGW
NVLLEYIIGGAAVARAWSGYLDSMFSHSIRNFTETHMGSWQVPLLGHYPDFLAAGIILLA
SAFVSCGARVSSWLNHTFSAISLLVILFIVILGFILAQPHNWSAEEGGFAPFGFSGIMAG
TASCFYAFVGFDVIAASSEEAQNPRRSVPLAIAISLAIAAGAYILVSTVLTLMVPWHSLD
PDSALADAFYQRGYRWAGFIVAAGSICAMNTVLLSLLFSLPRIVYAMAADGLFFQVFAHV
HPRTQVPVAGTLAFGLLTAFLALLLDLESLVQFLSLGTLLAYTFVATSIIVLRFQKSSPP
NSPGPASLGPLTKQHSSFSDHLQLVDTAHASVPEPGELKPALRTYLGFLDGYSPGAVVTW
ALGIMLASAITIGCVLVFGDSTLHLPHWGYILLLLLTSVMFLLSLLVLGAHQQQYRKDLF
QIPMVPLIPALSIVLNICLMLKLSYLTWVRFSIWLLMGLAVYFGYGIRHSKENQRELPGL
NSTHYVVFPRGSLEETVQAVQPPSQAPAQDPGRME
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggcccgggggctgcccagcattgctagcctggcacgcttatgccagaagctgaaccgc
ctgaagccgctggaggactccaccatggagacgtcactgcggcgctgcctgtccacactg
gacctgactcttctgggcgtgggcggcatggtgggctcgggcctctacgtgctcacaggt
gccgtggccaaggaggtggctggccctgctgtgctcttgtccttcggtgtggccgctgtg
gcctccctgctggcagccctatgctatgcagaatttggggcacgtgtgccacgcactggc
tctgcctacctgttcacctacgtatccatgggtgagctgtgggccttcctcattggctgg
aatgttctcctcgaatacatcatcggtggcgccgccgtggcccgtgcctggagtggctac
ctggactctatgttcagccacagcatccgcaacttcactgagacccacatgggttcctgg
caggtgcccctcctgggccactacccggacttcctggctgctggcatcatcctcctggcc
tctgcctttgtctcctgtggagcccgcgtctcctcctggctcaatcacaccttctcggcc
atcagcctgcttgtcattctcttcattgtcatcctgggcttcatcctggcccagcctcac
aactggagcgctgaggaaggcggctttgcacccttcggcttctccggcatcatggccggc
actgcctcctgcttctatgctttcgtgggcttcgacgtcattgccgcctccagtgaggag
gcccagaacccacggcggtccgtgcctctggccatcgccatctcacttgccattgcagct
ggtgcctacatccttgtctccaccgtgctaaccctcatggtgccctggcacagcctggac
cctgactcagcgcttgcagatgccttctaccagcggggctacaggtgggctggcttcatc
gtggcagctggctccatctgcgccatgaacaccgtcctgctcagcctcctcttctccctg
ccacgcattgtctatgccatggccgctgatgggctcttcttccaggtgtttgcccatgtg
cacccccggacacaggtgcctgtggcgggcaccctggcgttcgggctcctcacggccttc
ctggcactgctgctggacctggagtcgctggttcagttcctgtcccttggcacactcctg
gcctacaccttcgtggccaccagcatcattgtgctgcgcttccagaagtcttccccgccc
aactccccaggcccagccagccttggccccctgaccaagcagcatagctccttctcagac
cacctacagctggtggacactgcgcatgcctccgtccctgagccaggggagctgaagcca
gccctgaggacctacctgggcttcttggatgggtacagccctggagcagtggtgacttgg
gcgcttggcattatgttggcctcggccatcaccataggctgtgtgctcgtctttggggac
tcgaccctgcacctcccacactggggttacatcctgctgctcctgctcaccagtgtcatg
tttctgctcagcctccttgtcctgggggctcaccagcaacagtatcggaaagacttattt
cagatccccatggttcccctgattccagccctgagcatcgtcctcaacatctgcctcatg
ctgaaactgagctatctgacctgggtgcgcttctccatctggctgctgatgggactcgca
gtgtatttcggctacggcatccggcatagcaaggagaaccagcgggagctgccagggctg
aactccacacactacgtggtattccccaggggcagcctggaggagacagtgcaggctgtg
cagccccccagccaggcaccagcacaggaccctggccgtatggagtag

DBGET integrated database retrieval system