KEGG   Pongo abelii (Sumatran orangutan): 100446406
Entry
100446406         CDS       T01416                                 

Gene name
PARD6A
Definition
(RefSeq) partitioning defective 6 homolog alpha isoform X1
  KO
K06093  partitioning defective protein 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04144  Endocytosis
pon04360  Axon guidance
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100446406 (PARD6A)
   04390 Hippo signaling pathway
    100446406 (PARD6A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100446406 (PARD6A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100446406 (PARD6A)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100446406 (PARD6A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100446406 (PARD6A)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     100446406 (PARD6A)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 100446406
NCBI-ProteinID: XP_002826595
Ensembl: ENSPPYG00000007464
UniProt: A0A663D8Z8 H2NR86
LinkDB
Position
16
AA seq 346 aa
MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVHQIPGLDVLLG
YTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEADSSGLAFASNSLQRRKKGLLLR
PVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSMR
VAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSH
NLIVTVKPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQ
GPPCWDLHPGCRRPGTRSSLPSLDEQDQASSGWGSRIRGDGSGFSL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcccggccgcagaggactccggcgcgcagtcccgatagcatcgtcgaggtgaagagc
aaatttgacgccgagttccgacgcttcgcgctgccccgcgcttcggtgagcggcttccag
gagttctcgcggttgctgcgggcggtgcaccagatcccgggcctggacgtgctacttggc
tatacggatgctcacggcgacctgctgcccctcaccaacgacgacagcctgcaccgagcc
ctggccagcgggcccccgccactgcgcctactggtgcagaagcgggcagaagctgactcc
agcggcctggcttttgcctccaactctctgcagcggcgcaagaaagggctcctgctgcgg
ccagtggcacccctgcgcacccggccacccttgctaatcagcctgccccaagatttccgc
caggtttcctcagtcatagacgtggacctactgcctgagacccaccgacgggtgcggctg
cacaagcatggttcagaccgcccccttggcttctacatccgagatggcatgagcatgcgt
gtggctccccagggcctggagcgggttccaggaatcttcatctcccgcctggtacgtggg
ggtctggctgagagtacagggctgctggcagtcagtgatgagatcctcgaggtcaatggc
attgaagtagctgggaagaccttggaccaagtgacggacatgatggttgccaacagccat
aacctcattgtcactgtcaagcccgccaaccagcgcaataacgtggtgcgaggggcatct
gggcgtttgacaggtcctccctctgcagggcctgggcctgctgagcctgatagtgacgat
gacagcagtgacctggtcattgagaaccgccagcctcccagttccaatgggctgtctcag
gggcccccgtgctgggacctgcaccctggctgccgacgtcctggtacccgcagctctctg
ccctccctggatgagcaggatcaggccagttctggctgggggagtcgcattcgaggagat
ggtagtggcttcagcctctga

KEGG   Pongo abelii (Sumatran orangutan): 100446683
Entry
100446683         CDS       T01416                                 

Gene name
PARD6B
Definition
(RefSeq) partitioning defective 6 homolog beta
  KO
K06093  partitioning defective protein 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04144  Endocytosis
pon04360  Axon guidance
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100446683 (PARD6B)
   04390 Hippo signaling pathway
    100446683 (PARD6B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100446683 (PARD6B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100446683 (PARD6B)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100446683 (PARD6B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100446683 (PARD6B)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     100446683 (PARD6B)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 100446683
NCBI-ProteinID: XP_002830461
Ensembl: ENSPPYG00000011128
UniProt: H2P2A5 A0A663DCY0
LinkDB
Position
20
AA seq 372 aa
MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQIEPSFEPEDEDSEEDDIIIED
NGVPQQIPKAVPNTESLESLTQIELSFESGQNGFIPSNEVSLAAIASSSNTEFETHAPDQ
KLLEEDGTIITL
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaaccgcagccaccggcacggggcgggcagcggctgcctgggtaccatggaggtgaag
agcaagtttggagctgaatttcgtcggttttcgctggaaagatcaaaacctggaaaattt
gaggagttttatggattactacaacatgttcataagatccccaatgttgacgttttggta
ggctatgcagacatccatggagacttactacctataaataatgatgataattatcacaaa
gctgtttcaacggccaatccactgcttaggatatttatacaaaagaaggaagaagcagac
tacagtgcctttggtacagatacactaataaagaagaagaatgttttaaccaacgtattg
cgtcctgacaaccatagaaaaaagccacatatagtcattagtatgccccaagactttaga
cctgtgtcttctattatagacgtggatattctcccagaaacgcatcgtagggtacgtctt
tacaaatacggcacggagaaacccctaggattctacatccgggatggctccagtgtcagg
gtaacaccacatggcttagaaaaggttccagggatctttatatccaggcttgtcccagga
ggtctggctcaaagtacaggactattagctgttaatgatgaagttttagaagttaatggc
atagaagtttcagggaagagccttgatcaagtaacagacatgatgattgcaaatagccgt
aacctcatcataacagtgagaccggcaaaccagaggaataatgttgtgaggaacagtcgg
acttctggcagttctggccagtctactgataacagccttcttggctacccacagcagatt
gaaccaagctttgagccagaggatgaagacagcgaagaagatgacattatcattgaagac
aatggagtgccacagcagattccaaaagctgttcctaatactgagagcctggagtcatta
acacagatagagctaagctttgagtctggacagaatggctttattccctctaacgaagtg
agcttagcagccatagcaagcagctcaaacacggaatttgaaacacatgctccagatcaa
aaactcttagaagaagatggaacaatcataacattatga

KEGG   Pongo abelii (Sumatran orangutan): 112129943
Entry
112129943         CDS       T01416                                 

Gene name
PARD6G
Definition
(RefSeq) partitioning defective 6 homolog gamma
  KO
K06093  partitioning defective protein 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04144  Endocytosis
pon04360  Axon guidance
pon04390  Hippo signaling pathway
pon04530  Tight junction
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112129943 (PARD6G)
   04390 Hippo signaling pathway
    112129943 (PARD6G)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112129943 (PARD6G)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112129943 (PARD6G)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    112129943 (PARD6G)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112129943 (PARD6G)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     112129943 (PARD6G)
SSDB
Motif
Pfam: PB1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 112129943
NCBI-ProteinID: XP_024091856
LinkDB
Position
18
AA seq 376 aa
MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYKLVVHTHHISNSDV
TIGYADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGA
LRDEGPRRRAHLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASV
RVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANS
HNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGLVGPPAPRVLQNFHPDEAESDEDND
VVIEGTLEPARPPQTPGAPAGSLSRVNGAGLAQRLQRDLALDGGLQRLLSSLRADPRHSL
ALPPGGVEEHGPAVTL
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaaccggagttttcacaagtctcagaccttgcgattctacgattgcagcgcagtggaa
gtcaagagcaagtttggggcggaattccgaaggttctctctggaccgtcataagcctggg
aagtttgaagatttctacaagctggttgtgcacacccaccatatctccaacagtgatgta
actattggctatgcagatgtgcacggagacctgctgcccatcaacaatgatgacaacttc
tgcaaggcggtttctagtgcaaatcccctgctcagggtcttcatccagaaacgagaggag
gccgagcgtggcagcctcggcgcgggctcgctgtgcaggcgcaggcgggcgctgggcgcg
ctgcgtgacgaaggaccccggcggcgtgcacacctggacatcggcctcccgcgcgacttc
cgccccgtatcgtccatcatcgatgtggacctggtccccgagacgcaccggcgagtgcgg
ctgcaccggcacggctgcgagaagccgctgggcttctacatccgcgatggcgccagcgtg
cgcgtgaccccgcacgggctggagaaggtgcccggcatcttcatctcgcgcatggtaccc
gggggcctggcggagagcaccgggctgctggctgtgaatgacgaggtcctggaggtgaac
ggcattgaggtggccgggaagacgctggaccaggtcacggacatgatgatcgccaacagc
cacaacctcatcgtcaccgtcaagcccgccaaccagcgcaacaacgtggtgcgtggcggc
cgcgcgttgggcagctcgggaccgccctcggacggcaccgcgggcctcgtgggtcccccc
gccccgcgcgtcctgcagaacttccaccccgacgaggcggagagcgatgaggacaacgac
gtcgtcatcgagggcacactggagcctgcacgtcccccccagaccccgggcgcgcccgca
ggcagcctctcccgggtcaatggcgcgggcctggcgcagcggctgcagcgggacctggcc
ctggacggcggcctccagcggctgctcagctccctgcgggccgacccacgtcacagtctg
gcgctgccgccaggcggcgtggaggagcacgggcccgcggtcacgctctag

DBGET integrated database retrieval system