KEGG   Pongo abelii (Sumatran orangutan): 100446468Help
Entry
100446468         CDS       T01416                                 

Gene name
GALNT17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00512  Mucin type O-glycan biosynthesis
pon01100  Metabolic pathways
Module
pon_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100446468 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pon01003]
    100446468 (GALNT17)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100446468 (GALNT17)
Glycosyltransferases [BR:pon01003]
 O-Glycan biosynthesis
  Mucin-type
   100446468 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100446468
NCBI-ProteinID: XP_024105901
LinkDB All DBs
Position
7
AA seq 534 aa AA seqDB search
MELVAARKDTRIPEERLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYL
SEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTPTHLL
KEIILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQVTGF
FDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELWCMYI
SPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLC
GGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLPLENP
GIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLDQGPL
ENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLDCDKV
KSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggagttggtggcagcaagaaaagataccaggattcctgaagagcgcttatccaaatcc
cttgggctcattgaaggttatggtgggcggggtaaagggggccttccggctactctttcc
cctgctgaagaagaaaaggctaaaggaccccatgagaaatatggctacaattcctacctc
agtgaaaaaatttcactggaccgttccattccggattatcgtcccaccaagtgtaaggag
ctcaagtactccaaggacctgccccagatatccatcatattcatcttcgtgaacgaggcc
ctgtcggtgatcctgcggtcagtgcacagtgccgtcaatcacacgcccacacacctgctg
aaggaaatcattctggtggatgacaacagtgacgaagaggagctgaaggtccccctggag
gagtatgtccacaaacgctaccccgggctggtgaaggtggtgagaaatcagaagagggaa
ggcctgatccgcgctcgcattgaaggctggaaggtggctactgggcaggtcaccggcttc
tttgatgcccacgtggaattcacagctggctgggctgagccggttctatcccgcatccag
gaaaaccggaagcgtgtgatcctcccctccattgacaacatcaaacaggacaactttgag
gtgcagcggtacgagaactcggcccacgggtacagctgggagctgtggtgcatgtacatc
agccccccaaaagactggtgggacgccggagacccttctctccccatcaggaccccagcc
atgataggctgctcgttcgtggtcaacaggaagttcttcggtgaaatcggtcttctggat
cctggcatggatgtgtacggaggagaaaatattgaactgggaatcaaggtatggctctgt
gggggcagcatggaggtccttccttgctcacgggtggcccacattgagcggaagaagaag
ccatataatagcaacattggcttctacaccaagaggaatgctcttcgcgttgctgaggtc
tggatggatgattacaagtctcatgtgtacatagcgtggaacctgccgctggagaatccg
ggaattgacattggtgatgtctccgaaagaagagcattaaggaaaagtttaaagtgtaag
aatttccagtggtacctggaccatgtttacccagaaatgagaagatacaataataccgtt
gcttacggggagcttcgcaacaacaaggcaaaagacgtctgcttggaccagggaccgctg
gagaaccacacagcaatattgtatccgtgccatggctggggaccacagcttgcccgctac
actaaggaaggcttcctgcacttgggtgccctggggaccaccacgctcctccctgacacc
cgctgcctggtggacaactccaagagtcggctgcctcagctcctggactgcgacaaggtc
aagagcagcctgtacaagcgctggaacttcatccagaacggagctatcatgaacaagggc
acgggacgctgcctggaggtggagaaccggggcctggctggcatcgacctcatcctccgc
agctgcacaggtcagaggtggaccattaagaactccatcaagtag

DBGET integrated database retrieval system